(data stored in ACNUC7421 zone)

EMBL: CP000094.PE47

CP000094.PE47        Location/Qualifiers
FT   CDS_pept        50798..52588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0047"
FT                   /product="putative two-component system, sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71791"
FT                   /db_xref="GOA:Q3KKB5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR031909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038320"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB5"
FT                   /protein_id="ABA71791.1"
FT                   /translation="MKLAMKLRTRLFLSISALITVALLGLMLGLVSVMQMAGTQEALIR
FT                   NNFVTLDLGLKLRQTLGDQLIMMLAEKPDPVAFEASKQHYFQLLDEGIAQEQKDDDRQY
FT                   GFSQAKADYLSFLQAFDISRDPAAALSGGGDLRERFNTLRNGLITEHKHALNNINSVQH
FT                   AARDRALLIAGLLGLVGLAVLIIGFVTAQGIARRFGAPIEALAKAADNIGQGNFEVTLP
FT                   VSSAMEINLLTRRFGLMAEALREHQATNVDELLAGQQRLQAVLDSIDDGLLMIDRQGRL
FT                   EHLNPVAQRQLGWDSDRFGEGLGTALQRPELDAQLQLVLRGGTLERAPEDLSIEVDGES
FT                   RLLTYSLTPVSHTQGHILGAVMVLHDVTEQRAFERVRSEFVLRASHELRTPVTGMHMAF
FT                   GLFRERAKFPEESRESDLLDTVNEEMQRLMQLINDLLNFSRYQSGLQKLTLAPCSIEEL
FT                   LERARLRFADSAAQKGVALNVEAQGSLPRLQADQAQLDRVLDNLIDNALRHTARDGLIR
FT                   LQARRHGERVIISVEDNGEGIAYGQQGRIFEPFVQVGRKKGGAGLGLALCKEIVQLHGG
FT                   RMGVYSRPGQGTQFYMALAV"
     atgaaactgg cgatgaagtt gcggactcgc ttgttcctga gcatttccgc gctgatcacc        60
     gtggccttgc tcgggttgat gctcgggctg gtcagtgtga tgcagatggc cggcactcag       120
     gaggcgctga tccgcaacaa ctttgtcacc ctggatctgg ggctcaagct gcgccagaca       180
     ctcggcgatc aactgatcat gatgctcgcc gaaaagcccg accccgtggc gttcgaagcg       240
     tccaaacagc attacttcca gttgctcgac gagggcatcg cccaagagca gaaagacgac       300
     gatcgccagt atggattcag tcaggccaaa gccgattacc tgagcttcct ccaggcgttc       360
     gacatctccc gcgacccggc tgctgccctg agcggcggtg gcgacttgcg tgagcgcttc       420
     aacaccttgc gcaacgggtt gatcaccgaa cacaaacacg cgctgaacaa catcaattcg       480
     gtccagcacg ccgctcgcga ccgcgcgttg ctgatcgctg gcctgttggg actggtgggg       540
     ctggcggtgc tgatcattgg cttcgttacc gcccagggca ttgcccggcg ttttggtgcg       600
     ccgatcgaag cgctggccaa agcggcggac aatatcggcc aaggcaattt cgaagtgacc       660
     ctgccagtgt cctcggcgat ggagatcaac ctcctgaccc ggcgcttcgg gctcatggcc       720
     gaagccctgc gcgaacatca ggcgaccaac gtcgacgaat tgcttgccgg ccagcagcgt       780
     ctgcaagcgg tactcgacag catcgatgac ggcttgttga tgatcgaccg tcagggtcga       840
     ctggaacact tgaacccggt ggcccagcgg caactgggct gggacagcga tcgcttcggc       900
     gagggcctcg gcacggcgct tcagcgaccc gagctggatg cacaactgca attggtactg       960
     cgcggcggta cccttgaacg ggcaccggaa gatttgagca tcgaggttga tggcgaatcg      1020
     cgcctgctga cctacagcct gacgcccgtc agtcataccc agggacatat cctcggtgct      1080
     gtgatggttt tgcatgacgt caccgagcaa cgcgccttcg aacgggtacg cagcgagttt      1140
     gtcctgcgtg cgtctcacga attgcgcaca ccggtcacgg gcatgcacat ggcgttcggg      1200
     ctgtttcgcg aacgggccaa gtttcctgag gagtctcggg agtccgacct gctcgacacg      1260
     gttaatgagg aaatgcagcg cctgatgcag ctgatcaacg atctgctgaa cttctcgcgc      1320
     tatcagagtg gtttgcaaaa acttacgttg gcgccttgct ccatcgagga actgctggag      1380
     cgggcgcgtt tgcgtttcgc cgattcagca gcgcagaagg gcgttgccct gaatgtcgaa      1440
     gcgcagggct cgctgccacg cttgcaggcg gatcaggcgc agcttgatcg agtcctcgac      1500
     aacctgatcg acaacgcctt gcgccacacc gcgcgcgacg ggctgatccg cttgcaggcc      1560
     cggcgccatg gcgagcgggt gatcatcagc gtcgaagaca acggtgaagg gattgcctac      1620
     ggtcagcagg ggcggatctt cgaacccttc gtccaggtcg gcaggaaaaa gggcggggcc      1680
     gggctcggtt tggcgctgtg caaggaaatc gtccagctgc acggtgggcg aatgggtgtt      1740
     tactcgcggc cggggcaggg cacgcagttc tacatggcgc tggcggtcta g               1791
//

If you have problems or comments...

PBIL Back to PBIL home page