(data stored in ACNUC7421 zone)

EMBL: CP000094.PE470

CP000094.PE470       Location/Qualifiers
FT   CDS_pept        546522..546893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0472"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72216"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ40"
FT                   /protein_id="ABA72216.1"
FT                   /translation="MLVCPDVPGGQILTIKNAIAIGAFSLALSGCGTAVTVLQGDEAAT
FT                   RGLRKQKTYCQSIPRIYSGLAHDFCLLHAPPDPTGILVPVVLLDLTLSGVFDTAFLPYT
FT                   IYRQAVDGNISVYWRPSRG"
     atgctagttt gccccgacgt tcccggaggg caaatcttga ccatcaaaaa cgctatcgcc        60
     atcggcgcat tttccctggc actgtccggc tgcggcaccg ccgtcacggt cttgcagggc       120
     gatgaagccg ccacgcgcgg cctgcgcaaa cagaagacct actgtcagtc gattccgcgc       180
     atctacagcg gactcgccca tgatttctgc ctgctgcacg cgccgcccga tcctaccggc       240
     attctggtac cggtcgtcct gctcgacctg accctgtccg gtgtgttcga cacggctttc       300
     ctgccgtata cgatctatcg ccaggcggtg gacgggaata tcagtgttta ttggcggcca       360
     agccgtggat ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page