(data stored in ACNUC7421 zone)

EMBL: CP000094.PE478

CP000094.PE478       Location/Qualifiers
FT   CDS_pept        complement(555573..557435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0480"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72224"
FT                   /db_xref="GOA:Q3KJ32"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ32"
FT                   /protein_id="ABA72224.1"
FT                   /translation="MQFSGFSSTSSRIFDFISLWILPVGYFLLLCALFFLPGRSLHHKL
FT                   FYGLFSIPTLIALCLRPRELKEMLREPVFIALLLFAGWALLSLCWGPQDEPIGGMFKPP
FT                   LHTLMLFAGCFLLVRYRSDILTPLLFAAALVALIATIAFLIPFMLHFEPGARLIGGGAF
FT                   DNPLLSSHLFGFFCAYWLSLSMTCKNRRLYWLSIPAMLIMFMAVIGTGSRTPLVALTMA
FT                   ALWLSLICWNRRSLVLLGTLAIGGATVVVLFSKMIIERGDSYRFEIWQQALEKIAEHPW
FT                   IGHGYNAVLAIDPGVGYNFQEPHSFALGVLYYVGILGMLPWLFFQAWGLLSSWRQRVQP
FT                   LLIIASTWLVFGIGAGLTEGGGIISRPKEHWFLLWIPLALIAALSINQRARRLLAMPVQ
FT                   KLSATALQQLSSDAQVIEEDGLGPKVLRLSDGSFLKLFRHRRWYTSGSFNPYSERFAVN
FT                   SEQLRRMGIPTPQVLNLYRLDDGSSAVHYTPLPGHTLRQVLQGITAPAVRHALVERFGK
FT                   FMASLHEQGVYFRSLHLGNVLVLEDGEFGLIDLADLRIYPSPLSLSLRQRNLRHMQRYT
FT                   VDRRWLFEDHLEALLQGYAVTASKSAVDNLHRQVLAGNTPARVH"
     atgcaattca gcggcttcag cagtacgtcc agtcgaattt tcgatttcat cagcctgtgg        60
     attcttcccg tcggctactt cctgctcttg tgcgcgctgt tcttcctgcc gggccgcagc       120
     cttcatcaca agctgtttta cggcctgttc agcattccga cgctgatcgc cctgtgcctg       180
     cgcccgcgtg aactcaagga aatgctgcgt gaaccggtgt tcatcgcact gctgctgttt       240
     gccggctggg cgttactcag tctttgctgg ggtccgcagg atgaaccgat aggcggcatg       300
     ttcaaacctc cgttgcatac cctgatgctg ttcgccgggt gttttctgct ggtccgctac       360
     cgcagcgaca tcctgacccc gttgctgttc gccgccgcac tggtggccct gatcgcaacg       420
     atcgccttcc tgattccgtt catgctccac ttcgaacccg gcgcgcgcct gatcggcggc       480
     ggcgcgttcg acaacccgct gctcagctcc catctgttcg gatttttctg cgcctactgg       540
     ctcagtctga gcatgacctg caagaatcgc cggctgtact ggctcagcat ccctgcgatg       600
     ctgatcatgt tcatggccgt gatcggaacc ggttcccgca ctccgctggt ggcgctgacc       660
     atggccgcat tgtggctcag cctgatttgc tggaaccgtc gctcactggt actgctgggc       720
     acactcgcga tcggtggcgc aacggtggtg gtgctgttct cgaaaatgat catcgaacgc       780
     ggtgactcct atcgtttcga gatctggcag caagccctgg aaaaaatcgc cgagcatccg       840
     tggatcggcc acggttacaa cgcggttctg gcgattgacc caggcgtcgg ttacaacttc       900
     caggaaccgc acagctttgc gctgggagtg ctttattacg tcggcatcct cggcatgctg       960
     ccctggctgt ttttccaggc ctgggggctg ctgagcagct ggcgtcagcg cgtgcagcca      1020
     ttgctgatca tcgcctcgac ctggctggtg ttcggcatcg gtgccgggct gaccgaaggc      1080
     ggcggaatca tttcccgccc caaggaacac tggttcctgc tgtggattcc tttggcgctg      1140
     attgcggccc tgagcatcaa tcaacgtgcc cgacggcttt tggcaatgcc ggtacaaaag      1200
     ctgtcggcaa ccgctctgca acagctgagc agcgacgccc aggtcatcga ggaagatgga      1260
     ttggggccca aggtcctgcg cctgtccgat ggcagtttcc tcaaactgtt tcgccatcgc      1320
     cgctggtata catcgggcag cttcaacccg tattccgagc ggtttgccgt caacagcgaa      1380
     cagctgcgcc ggatgggcat tcccacgcca caggtgctca acctctatcg cctcgacgac      1440
     ggcagcagcg ccgtgcatta cacgccgctg ccgggccaca ccctgcgcca ggtgctgcag      1500
     gggatcaccg cgcctgcagt gcgtcatgcg ctggtggagc gtttcggcaa attcatggcc      1560
     agcctgcatg agcaaggcgt gtatttccgc tcgctgcatc tgggcaatgt gctggtgctg      1620
     gaagacggag agttcgggct gatcgatctg gccgacctgc ggatctaccc ttcccccctc      1680
     agcctgtcac tgcgccagcg taatctgcgc cacatgcaac gctacaccgt cgacagacgc      1740
     tggctgttcg aggatcacct cgaggcactg ctccagggat acgccgtaac ggcgtcgaaa      1800
     tccgccgtag acaatctgca caggcaagtg ctggccggca acacgccggc tagggttcat      1860
     tga                                                                    1863
//

If you have problems or comments...

PBIL Back to PBIL home page