(data stored in ACNUC7421 zone)

EMBL: CP000094.PE479

CP000094.PE479       Location/Qualifiers
FT   CDS_pept        557590..559392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0481"
FT                   /product="lipid A export ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72225"
FT                   /db_xref="GOA:Q3KJ31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJ31"
FT                   /protein_id="ABA72225.1"
FT                   /translation="MTDSSPAASPSSLKIYFRLLGYVRPYISLFLISIVGFLIFASTQP
FT                   MLGYILKYFVDGLSNPEAVLFPTVPYLRDLQLLQAVPLLIILIAAWQGLGSYLGNYFLA
FT                   KVSLGLVHDLRVQLFNNLLVLPNRYFDKHNSGHLISRITFNVTMVTGAATDAIKVVIRE
FT                   GMTVIFLFASLLFMNWKLTLVMVAILPLIAVMVRTASKKFRKQSKKIQLAMGDVTHVAS
FT                   ETIQGYRVVRSFGGEAYEEKRFLDASQGNTDKQLRMTRTGAIYTPLLQLVIYSAMAILM
FT                   FLVLYLRGDASAGDMVAYITLAGLLPKPIRQLSEVSSTIQKGVAGAESIFEQLDVEPEV
FT                   DTGTVERDSVSGRLDVRNLSFTYPGTERQVLDDISFSVEPGQMVALVGRSGSGKSTLAN
FT                   LIPRFYHHDKGEILIDGVEVEQYKLLNLRRHIAQVTQHVTLFSDTVANNIAYGDLAGAP
FT                   REDIEKAARDAYAMDFIAQLPEGLDTQVGENGVLLSGGQRQRLAIARALLKNAPLLILD
FT                   EATSALDTESERHIQAALDQVMKGRTTLVIAHRLSTIEKADLILVMDQGRIVERGTHDD
FT                   LLAQNGYYARLNAMGLDAPAEDIA"
     atgaccgatt ccagtcccgc cgcaagccct tcgagcttga aaatctactt ccgcctgctc        60
     ggctatgtcc ggccgtacat cagtctgttc ctgatcagca tcgtcggttt tctgattttt       120
     gcctcgaccc agccgatgct cggctacatc ctcaagtact ttgtcgacgg tctgtccaat       180
     cccgaggcag tgctgtttcc caccgtgcct tacctgcgcg acctgcaact gctgcaggcc       240
     gtaccgttgc tgatcatcct gatcgccgcg tggcaggggc tgggatctta tctgggcaac       300
     tatttcctgg ccaaggtttc cctgggcctg gtgcatgacc tgcgggttca gctcttcaac       360
     aacctgctgg tcctgcccaa ccggtatttc gacaagcata actccggaca tctgatttcg       420
     cgtatcacct tcaacgtgac aatggtcacg ggggcggcaa cagatgcgat caaggtcgta       480
     atccgtgaag gcatgacggt gatcttcctg ttcgcctccc tgctgttcat gaactggaag       540
     ctgacgctgg tgatggttgc gatcctgccg ctgatcgccg taatggtgcg cactgccagc       600
     aagaaattcc gcaagcagag caagaaaatc cagctggcca tgggcgacgt gacccacgtc       660
     gcctcggaaa ccatccaggg ctatcgcgtg gtgcgcagct tcggtggcga agcctacgag       720
     gaaaaacgct ttctcgatgc cagccagggc aacaccgaca agcagttgcg catgacccgc       780
     accggggcca tctacacgcc gctgctgcag ctggtgatct acagcgccat ggcgatcctg       840
     atgttcctcg tgctgtacct tcgcggcgat gcgtcggccg gtgatatggt ggcctacatc       900
     acgctggcgg gcctgctgcc caagccgatc cgccagttgt ccgaagtcag ttcgaccatc       960
     cagaagggcg tggccggtgc cgaaagcatt ttcgagcaac tggacgtcga accggaggtc      1020
     gataccggca cggtcgagcg cgactcggtc agcggtcgcc tcgacgtgcg caacctgagt      1080
     ttcacctacc cgggcaccga gcgtcaggta ctcgacgaca tcagtttctc ggtcgagccg      1140
     gggcagatgg tggcgctggt ggggcgttct ggcagcggca agtcgaccct ggccaacctg      1200
     attccgcgct tctatcacca cgacaagggc gagatcctga tcgacggcgt ggaagtggag      1260
     caatacaagc tgctcaacct gcgccgccac attgcccagg tgacccagca cgtcacgctg      1320
     ttcagcgaca ccgtggccaa caacatcgct tatggcgatc tggccggggc gccgcgcgaa      1380
     gacatcgaga aggccgcgcg tgatgcttat gcgatggact tcatcgcgca actgcctgaa      1440
     ggcctggaca cccaggtcgg cgaaaacggc gtgctgctct ccggcggtca gcgccagcgt      1500
     ctggcaattg cccgcgccct gctcaagaac gcgccgctgc tgattctcga cgaggctacc      1560
     tcggcactcg acaccgaatc cgaacggcac attcaggccg ccctggatca agtgatgaag      1620
     ggccgcacca cgctggtgat cgctcaccgg ctgtcgacca tcgagaaggc cgacctgatt      1680
     ctggtcatgg accagggccg gatcgtcgag cgcggcaccc acgacgactt gctggcacag      1740
     aacggctact acgcgcgtct caatgccatg ggcctcgatg ccccggcgga agacatcgcc      1800
     tga                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page