(data stored in ACNUC7421 zone)

EMBL: CP000094.PE48

CP000094.PE48        Location/Qualifiers
FT   CDS_pept        complement(52585..54201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71792"
FT                   /db_xref="GOA:Q3KKB4"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB4"
FT                   /protein_id="ABA71792.1"
FT                   /translation="MMVATRETLRSWFYRPWFLAMIAAVLSASLLITGGLFVAMRQVEQ
FT                   SESQEMNAQGERFLARLEQLFGQLRESLDDLEAQPLRSCDDEMIATLQQVTFNYRFVYE
FT                   AAYMDATRICSNRPRQEGLSVIRPPDIKGPTYSYWLNTTTEPDENRAALMLGRGNFRVA
FT                   TSRGHLTDMVDLSPGSSLLVVLDHGTRAIPVLGVPQAWPPTEPWPPKTPNALQVTQSHL
FT                   IYRMPTDNPEYQLVLISPRTGMHIPELWWWMVPFCLVLGAFVGVLVFWIVRQRQSLDAE
FT                   LHGAIRRGELQVLYQPIFDLDSRNCVGAEALLRWRRPDGTLTSPDLFIPMAENTGQIRQ
FT                   MTDFVLQRLLEQLGQLLRANPQLYISVNLAACDVMVPRIGQVMARLLTLHRVAARQIAF
FT                   EVTERGLIDVVVARENLQALRDVGHQVLIDDFGTGYCSLAYLQTLPVDCLKIDKAFIDA
FT                   LGHDAASSGVAPHIIHMAQALDLKVIAEGIEFESQAALLSSEGVKFGQGWLFAHALSAV
FT                   QFIELITRGRRLAGRRLDDEA"
     atgatggttg ctacccgaga gacgctgcgt agctggtttt atcgcccctg gtttctggcg        60
     atgatcgcgg ctgtcctcag tgcgagcctg ctgatcaccg gtgggctgtt cgtggccatg       120
     cgccaggtcg aacaaagcga aagccaggaa atgaacgctc agggcgagcg gttcctggcg       180
     cgtctggagc aactgttcgg ccagttgcgc gaaagcctcg acgacctcga agcccagccc       240
     ttgcgaagtt gcgacgacga aatgatcgcc acgttgcagc aagtgacgtt caactatcgc       300
     ttcgtctatg aagcggccta catggatgcc acgcggatct gctcgaaccg cccgcgtcag       360
     gaaggcctgt cggtgatccg ccctccggac atcaaaggcc cgacgtacag ctattggctg       420
     aacaccacca ccgaacccga tgaaaatcgc gcagcgttga tgctcgggcg cggcaacttt       480
     cgcgtggcca cctcacgcgg gcatctgacc gacatggttg atctgtcgcc cggcagcagt       540
     ctgctggtgg tgctcgatca tggaacccga gcgattccgg tacttggcgt gccacaggcc       600
     tggccaccca ccgagccctg gccgccgaaa accccgaatg cgctgcaagt tacccagtcg       660
     cacctgatct atcgcatgcc caccgacaac ccggaatacc aactggtgct gatcagccca       720
     cgcacgggca tgcacattcc ggagctctgg tggtggatgg tgccgttctg cctcgtgctt       780
     ggggcgtttg tcggagttct ggtgttctgg atcgtccgcc agcgccaatc gctggacgca       840
     gagctgcacg gcgcgatccg ccggggcgaa ttgcaggtgc tgtatcaacc gatcttcgat       900
     ctcgacagtc gcaactgcgt cggcgccgaa gccctgctgc gctggcgccg gccggacggc       960
     acgctgacca gccctgacct gttcatcccg atggccgaga acaccgggca gattcgccag      1020
     atgaccgact tcgtcctgca acgcttgctc gagcagctcg gccagctgct gcgagccaat      1080
     ccgcaactgt acatctcggt gaacctggcc gcctgcgacg tgatggtgcc gcgcatcggc      1140
     caggtcatgg cgcggctgtt gaccctgcac cgggtcgcgg cgcggcagat tgcttttgag      1200
     gtgaccgaac gtggcctgat cgatgtggtg gtggcccggg aaaacctgca agcgctgagg      1260
     gatgtcggcc atcaagtgct gatcgacgat ttcggcaccg gttattgcag cctggcgtac      1320
     ctgcaaacct tgccggtgga ctgcctgaag atcgacaagg cattcatcga cgccctcggc      1380
     catgacgccg ccagcagcgg tgtcgcgccg cacatcattc acatggccca ggccctggac      1440
     ctgaaagtga tcgccgaagg tatcgaattc gagtcccagg cggcactgct gagcagcgaa      1500
     ggagtgaagt tcggccaagg ctggctgttc gcccacgcct tgagcgcggt gcagttcatc      1560
     gagctgataa cacgtggacg gcgactcgcc gggcgccggt tggacgatga ggcctag         1617
//

If you have problems or comments...

PBIL Back to PBIL home page