(data stored in ACNUC7421 zone)

EMBL: CP000094.PE485

CP000094.PE485       Location/Qualifiers
FT   CDS_pept        complement(564268..565443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72231"
FT                   /db_xref="GOA:Q3KJ25"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ25"
FT                   /protein_id="ABA72231.1"
FT                   /translation="MPSPISTDVLIVGAGVAGLWLNARLRRQGFSTVLVESASLGGGQS
FT                   VKSQGIIHGGAKYALHGALTGASEAIADMPRRWREALAGNGELDLTGVRLLSEAHYLWS
FT                   PGTLAGNLTSFFASKAVRGRVDQVKGDQLPLALQDKRFKGKVYRLAELVIDVPSLIQRL
FT                   ADLSGDGLLAGQNIEPLLESGVLVGLKVDGREIRAQRIVLSAGAGTADLLTALGLTHPA
FT                   MQRRPLHMIIAKGPGLKPLYAHCLGGGTKPRITVTTHPAADGQWVWYLGGDIAESEGVA
FT                   REPAEQIATAQKELGQLLPWIDLSTVQWATLRVDRAEPLQTGLTRPDNAFLAEDGRLLV
FT                   GWPTKLALAPDFADRVIASLERDGIQPSHPGPLPELPKPPMGVPAWEQLLP"
     atgccatctc caatttccac cgacgtgctg attgtcggcg cgggtgtcgc cggtctctgg        60
     ctgaacgcgc gcctgcgtcg ccagggtttc tcgaccgtgc tggtggaaag cgccagcctc       120
     ggcggcgggc agagtgtgaa gtcacagggc atcattcacg gcggcgccaa gtacgcgctg       180
     cacggtgcgt tgaccggcgc ctcggaagcc atcgccgaca tgccgcgccg ctggcgtgag       240
     gccctggccg gcaacggcga actggacctg accggcgtgc gcctgctgtc cgaagcccat       300
     tacctgtggt cgccgggcac cctcgccggc aacctcacca gtttcttcgc cagtaaagcg       360
     gtgcgtggcc gggtcgatca ggtcaagggc gatcaactgc cgctggcgtt gcaagacaag       420
     cgcttcaaag gcaaggtcta ccgcctcgcc gaactggtga tcgatgtacc gagcctgatc       480
     cagcgtctgg ccgacctgtc gggcgacggt ctgctcgccg gccagaacat cgagccgttg       540
     ctggaaagcg gcgtgctggt tggcctgaaa gtcgatggcc gtgagatccg tgcccagcgc       600
     atcgtgctca gcgccggcgc cggcactgcc gatctgctga ccgctttggg cctgactcat       660
     ccggccatgc aacggcggcc gctgcacatg atcatcgcca agggtccggg cctgaagccg       720
     ctgtacgcgc actgcctcgg tggcggcacc aagccgcgca tcaccgtgac cacccacccg       780
     gccgctgacg gccagtgggt ctggtatctg ggtggtgaca tcgccgaatc cgaaggcgtg       840
     gcccgtgagc cggccgaaca gatcgccacc gcccagaaag aacttggcca gttgttgcca       900
     tggatcgacc tgagcaccgt gcaatgggcg accctgcgcg tcgatcgcgc cgaaccgctg       960
     caaaccggcc tgacccgccc ggacaacgcc ttcctcgccg aagacggtcg cctgctggtg      1020
     ggttggccaa ccaagctcgc cctggcgccg gacttcgctg accgggtgat tgcctccctg      1080
     gaacgcgacg gtatccagcc gagccatcct ggtccgctgc ccgagctgcc aaaaccaccg      1140
     atgggcgttc ccgcctggga gcaattgctg ccatga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page