(data stored in ACNUC7421 zone)

EMBL: CP000094.PE486

CP000094.PE486       Location/Qualifiers
FT   CDS_pept        complement(565573..565905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0488"
FT                   /product="quaternary ammonium compound-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72232"
FT                   /db_xref="GOA:Q3KJ24"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ24"
FT                   /protein_id="ABA72232.1"
FT                   /translation="MNAYVYLAIAICAEVIATVSMKAVKGFSTPLPLLLVVVGYGIAFW
FT                   MLTLVVRSVPVGVAYAVWAGMGIVMVSVAALFIYGQKLDIPAMLGMALIVLGVVVIQLF
FT                   SKTAGH"
     atgaacgctt acgtctacct ggccatcgcc atctgtgccg aagtgatcgc gaccgtctcg        60
     atgaaagccg tcaaaggctt cagcacgcca ttgccactgc tgctggtcgt cgtcggttat       120
     ggcatcgcgt tctggatgct gaccctggtg gtgcgcagcg taccggtggg cgtggcctac       180
     gcggtgtggg ccggcatggg catcgtgatg gtcagcgtcg cggcgctgtt catttatggg       240
     cagaagctgg atatcccggc gatgctcggg atggcgctga tcgtgctcgg cgtggtggtg       300
     attcagctgt tctcgaaaac cgccggccat tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page