(data stored in ACNUC7421 zone)

EMBL: CP000094.PE487

CP000094.PE487       Location/Qualifiers
FT   CDS_pept        566008..566910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0489"
FT                   /product="putative LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72233"
FT                   /db_xref="GOA:Q3KJ23"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ23"
FT                   /protein_id="ABA72233.1"
FT                   /translation="MSMQWNLEQLRVFVEVAEQRSFSAVARQQRKAQSAISSAIAMLED
FT                   DLGVSLFERSSGRQPSLTEAGEALLEEAREVLRQCERLNGRAVAMMRGQEAQLRVAQDE
FT                   AMPYQALVESFGALAEQFPSLEVQLTSAAQGEVSRKLVERRADLGLLFYHDEIPEALER
FT                   RVLGSVEMVTVCGVNHPLASQAYVTCQQLAQHRQLLMSTQTSIYPGNEPASPQVWRADS
FT                   FYVMAEWLVRDLGWAWLPRHVVQYSAYQGLMVELDSEWTPPALVVELVWRRDEPLGPAA
FT                   RWLAERFAIHLRAIGGKSR"
     atgagcatgc agtggaatct ggagcaattg cgggtgttcg tcgaggtggc cgaacagcgt        60
     tcgttctccg ccgtggcgcg gcagcaacgc aaggcacagt cggcgatcag cagcgcgatt       120
     gccatgctcg aggacgatct cggcgtgagt ctgttcgagc gtagcagcgg ccgccagccg       180
     agtcttaccg aagcggggga ggcgttgctg gaagaggcgc gggaagtgtt gcgccaatgc       240
     gagcgcctga acggccgggc cgtggccatg atgcgcgggc aggaagcgca attgcgggtg       300
     gcccaggacg aggcgatgcc ctatcaggcg ctggtggaaa gtttcggcgc cctggccgag       360
     cagtttccca gtcttgaagt ccagttgacc agcgccgccc agggcgaggt ttcgcgcaag       420
     ctagtggagc gccgggccga tctcgggttg ttgttctatc acgatgaaat ccctgaagcg       480
     ctggagcgcc gggtgctggg cagtgtggaa atggtcacag tctgcggcgt caaccatccc       540
     ttggcatcgc aggcttacgt cacctgccag caactggctc agcatcggca gttgttgatg       600
     tcgacccaga ccagcattta tcccggcaac gaaccggcca gtccgcaggt gtggcgcgct       660
     gacagcttct atgtgatggc cgaatggctg gtgcgcgatc tcggctgggc ctggctgccg       720
     cgtcacgtgg tgcagtactc ggcgtatcag gggctgatgg tggagctcga cagcgaatgg       780
     acgccgccgg cgctggtggt ggaactggtc tggcgccgcg acgaaccgct tggcccggcc       840
     gctcgctggc tggcggagcg atttgccata cacctgcggg cgatcggcgg caaaagccga       900
     taa                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page