(data stored in ACNUC7421 zone)

EMBL: CP000094.PE496

CP000094.PE496       Location/Qualifiers
FT   CDS_pept        576434..577042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72242"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ14"
FT                   /protein_id="ABA72242.1"
FT                   /translation="MSGSILYIHGFNSAPASKKACQLVEVMERLGLSDQLRVPALHHHP
FT                   REAIGQLEQAIAELGRPLLVGSSLGGYYATHLAERHGLKALLVNPAVSPHRMFDGYLGT
FT                   QKNLYTDETWELTHDHVTALAELEVPAPQDLQRYQVWLQTGDETLDYRLAQQYYRACAL
FT                   RIQAGGDHSFQGFVTQLPALLSFAGIGADTYQAIDFTAL"
     atgtccggtt cgattctcta tatccatggt ttcaacagcg cgccggcctc gaagaaggcc        60
     tgtcagctgg tcgaggtgat ggagcggctg ggtttgagcg atcaactgcg tgtcccggcg       120
     ctgcatcacc acccgcgcga agccatcggt cagctggagc aggcaatcgc cgaactcggc       180
     cggccattgc tggtgggaag ctcgctcggc ggctactatg cgactcacct ggccgagcgc       240
     catggcctga aagccttgct ggtcaacccg gccgtcagtc cacaccggat gttcgacgga       300
     tacctgggca cccagaaaaa cctgtacacc gacgaaacct gggagctgac ccacgaccac       360
     gtgacggccc tggccgagct ggaagtgccg gcgccgcagg atctgcagcg atatcaggta       420
     tggttgcaga ccggggatga aacgctggat tatcgcctcg cccagcagta ttaccgggcc       480
     tgtgccttgc gcattcaggc cggcggcgac catagtttcc agggatttgt tacacaattg       540
     ccggcattgc tcagctttgc cgggattggc gccgatacct atcaggcaat cgatttcacc       600
     gcactgtga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page