(data stored in ACNUC7421 zone)

EMBL: CP000094.PE497

CP000094.PE497       Location/Qualifiers
FT   CDS_pept        577085..578992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0499"
FT                   /product="topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72243"
FT                   /db_xref="GOA:Q3KJ13"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ13"
FT                   /protein_id="ABA72243.1"
FT                   /translation="MATPSASSYNADAIEVLSGLDPVRKRPGMYTDTSRPNHLAQEVID
FT                   NSVDEALAGHAKSIQVILHADHSLEVCDDGRGMPVDIHPEEGVSGVELILTKLHAGGKF
FT                   SNKNYQFSGGLHGVGISVVNALSTQVRVRVKRDGNEYEMTFADGFKATDLQVIGTVGKR
FT                   NTGTSVYFAPDPKYFDSPKFSISRLKHVLKAKAVLCPGLLISFEDKGTGEKVEWHYEDG
FT                   LRSYLVDAVSEFERLPDAPFCGNLAGTKEAVEWALLWLPEGGTSVTESYVNLIPTEQGG
FT                   THVNGLRQGLLDAMREFCEFRSLLPRGVKLAPEDVWERIAFVLSMKMQEPQFSGQTKER
FT                   LSSREAAAFVSGVVKDAFSLWLNANPETGLALAELAISNAGRRLKASKKVERKRITQGP
FT                   ALPGKLADCAGQDPMRSELFLVEGDSAGGSAKQARDKEFQAILPLRGKILNTWEVDGSE
FT                   VLASQEVHNIAVAIGVDPGAEDMSQLRYGKICILADADSDGLHIATLLCALFVQHFRPL
FT                   VDAGHVYVAMPPLYRIDLGKEIYYALDEAERDGILDRLVAEKKRGKPQVTRFKGLGEMN
FT                   PPQLRETTMDPNTRRLVQLTLGGDFAETSEMMDMLLAKKRAGDRKTWLESKGNLAEVLA
FT                   "
     atggccactc ccagcgctag ctcctataac gccgacgcca tcgaagtcct ctcgggcctc        60
     gacccggtgc gcaaacgccc cggcatgtac accgacacca gtcggccgaa ccaccttgcc       120
     caggaagtca tcgacaacag tgtcgacgaa gccctggccg gccacgccaa atcgattcag       180
     gtcatcctcc acgccgacca ctcgctggaa gtctgcgacg acggccgtgg catgccggtc       240
     gacatccacc cggaagaggg ggtgtctggc gttgaactga tcctcaccaa gctccatgcg       300
     ggcggcaagt tttccaacaa gaactaccag ttctccggcg gtctgcacgg ggtgggtatt       360
     tccgtggtca acgccttgtc gacccaggta cgggtgcggg tcaagcgtga cggcaacgaa       420
     tacgaaatga ccttcgccga cggcttcaag gccaccgatc tgcaagtgat cggcaccgtc       480
     ggcaagcgca ataccgggac cagcgtgtac ttcgcgccgg acccgaaata ctttgactca       540
     ccaaaattct ccatcagccg cctcaagcat gtgctcaagg ccaaggccgt tctgtgcccg       600
     gggctgctga tcagcttcga agacaaaggc accggcgaaa aggtcgagtg gcattacgag       660
     gatggcttgc gctcctatct ggtggacgcg gtcagcgaat tcgagcgtct gccggatgcc       720
     ccgttctgcg gcaacctggc cggcaccaag gaagcggtcg agtgggcgct gctgtggctg       780
     ccggaaggcg gcacctcggt cactgaaagc tacgtcaacc tgatcccgac ggagcagggc       840
     ggcacccacg tcaacggtct gcgtcagggc ctgctcgatg cgatgcgcga attctgcgag       900
     ttccgcagcc tgctgccgcg cggcgtgaag ctggcgccgg aagacgtctg ggagcgcatt       960
     gctttcgtcc tgtcgatgaa gatgcaggaa ccgcaattct ccggccagac caaagagcgc      1020
     ctgtcatccc gtgaagcggc ggctttcgtt tccggtgtgg tcaaggacgc gttcagcctg      1080
     tggctcaacg ccaacccgga aaccggtctg gccctggcag agctggcgat cagcaacgcc      1140
     ggccgtcgtc tgaaggccag caaaaaagtc gagcgcaaac gcatcaccca gggaccggca      1200
     ttgccgggca aactggccga ctgtgccggg caggacccga tgcgttccga gctgttcctg      1260
     gtggaaggtg attccgccgg cggttcggcc aaacaggcgc gggacaagga gttccaggcg      1320
     atcctgccgt tgcgcggcaa gatcctcaac acctgggaag tcgacggcag cgaagtgctg      1380
     gccagccagg aagtgcacaa catcgcggtg gccatcgggg tcgatccggg cgccgaggac      1440
     atgagccagc tgcgctacgg caagatttgc atcctcgccg acgccgactc cgacggcctg      1500
     cacatcgcga ccctgctctg tgccttgttc gtccagcatt tccgcccgct ggtggatgcc      1560
     ggtcacgtct atgtcgcgat gccgccgttg taccgcatcg acctgggcaa agagatctac      1620
     tacgccctcg acgaagccga gcgcgacggg atcctcgacc gtctggtcgc cgagaagaaa      1680
     cgcggcaagc cgcaggtcac ccgattcaaa ggcctgggtg aaatgaaccc gccgcaactg      1740
     cgcgaaacca ccatggaccc gaacacccgg cgcctggtgc agttgaccct cgggggcgac      1800
     ttcgccgaga cctcggaaat gatggacatg ctgctggcga aaaaacgcgc cggcgaccgc      1860
     aagacctggc tcgaatccaa gggtaacctc gccgaggttc tggcctga                   1908
//

If you have problems or comments...

PBIL Back to PBIL home page