(data stored in ACNUC7421 zone)

EMBL: CP000094.PE498

CP000094.PE498       Location/Qualifiers
FT   CDS_pept        578992..579981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0500"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72244"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ12"
FT                   /protein_id="ABA72244.1"
FT                   /translation="MRFGRALAGALLLGSMTVSAEPAQELRVLAEHPVEGMRGGNLSGL
FT                   ALCGNDLWTVSDRDDDQIYRLDTRDPVWQATAVRIDPPPVPDSGLPWGIKSRTWAASFV
FT                   RGGDLDFEGITCDSAGNRYIVSEGHAAVLQVPPQGPSSWLKISPMMVREARASGMLLQF
FT                   NAIFEGLAINPAGDQMWLAAERQSRGLLLIKRQQTVWDCDGRCVLLSEGGMEMQPPQFP
FT                   KARPVNRDFSDVSLFDGKLFTLERNAYQICRRDAQTAKVELCWSYAAELLQANRRYSQN
FT                   FGLEEALVVDAQGAWIGVDNNFGPRADGEVRPIIWRFAAPEGGWSAKP"
     atgcggtttg gccgggcctt ggcgggtgcg ttgctgctgg gttcgatgac ggtgtcggcg        60
     gagcctgcgc aagaactgcg cgtgctcgcc gaacacccgg tcgaaggcat gcgcggcggc       120
     aacctgtcgg ggctggcctt gtgcggcaat gacctgtgga ccgtttcgga tcgcgacgat       180
     gaccagattt atcgtctcga tactcgcgat cccgtctggc aggcgactgc cgtgcgcatc       240
     gacccgccgc cagtacccga cagcggtttg ccgtggggca tcaagtcgcg gacctgggcg       300
     gcgtcgtttg ttcgcggcgg tgatctggat ttcgaaggga tcacctgcga cagcgccggc       360
     aatcgctaca ttgtcagcga aggccacgcc gccgtactgc aagtgccgcc gcaggggccg       420
     tcgtcgtggc tgaaaatctc gccgatgatg gttcgcgaag cgcgggccag tggcatgttg       480
     ctgcaattca acgcgatatt cgaaggcctg gcgatcaatc cggcgggcga tcagatgtgg       540
     ctggccgccg agcggcaaag ccgtggcttg ttgctgatca agcgccagca gacggtgtgg       600
     gattgtgacg gtcgctgcgt actgctcagc gaaggcggga tggaaatgca accgccgcag       660
     tttcccaaag cccgaccggt caatcgggat ttttccgacg tgtccctgtt cgacggcaaa       720
     ctgtttaccc ttgagcgcaa cgcctaccag atctgtcgcc gtgatgcgca gacggccaag       780
     gtcgagctct gctggtcgta tgcggccgag ctgttgcagg ccaatcggcg ttattcgcag       840
     aacttcgggc tggaagaggc gctggtggtc gatgctcaag gtgcctggat cggcgtcgac       900
     aacaacttcg gcccgcgcgc cgatggcgag gtccgcccga tcatctggcg tttcgccgcg       960
     cctgaggggg gctggagcgc caagccttag                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page