(data stored in ACNUC7421 zone)

EMBL: CP000094.PE503

CP000094.PE503       Location/Qualifiers
FT   CDS_pept        complement(585425..586939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0505"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72249"
FT                   /db_xref="GOA:Q3KJ07"
FT                   /db_xref="InterPro:IPR019305"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ07"
FT                   /protein_id="ABA72249.1"
FT                   /translation="MNRPTPVKTDNFFLLIFRALRHRRVPIALRIASHNVILVALALVI
FT                   YACVMGLQFKQAMHEQADALGESLTTQTATSATELLVSNDILSLNVLLNNLTKNKLVAH
FT                   AAIYSVDNRILAESGQRPKHGLLGEAEGMYESKITFQDVTAGQLRISLDMDQFQQPMTI
FT                   SLQSMGILSAILLALSLALSLRLGRHISTPLLQLRVWLRRIDEYTPGIERQDEIGDLAR
FT                   QLHANYAPEPAEPEPEPEPEFEDDDIEPEFEVRNLRDPSFDESRPMAAQKPAPRHVVST
FT                   VEDDDDEDPFADLRDESLSEAAQPAVRRPTPSVPQHTAVLAVQLGSQEQLRRLPRARLE
FT                   ELQDRYRDCLDQAASLYQGEIETLNDGSTLMLFHTEDSGDDYLTNAICCGELLRALGHQ
FT                   LQIEVADSGITLQLQLGLTLGDELFGLSQIDLLLTDSAQDALALSQHSRNLLLVERKIG
FT                   DDALIRQRARIRPIASPEGACCVERLMEPYPSMLERQLARMHERRA"
     gtgaaccggc ccacgccagt taaaaccgat aacttctttc tgctgatctt ccgtgcactg        60
     cgccaccgcc gtgtaccgat tgcattgcgc attgccagcc ataacgtgat cctggtcgct       120
     ctggccctgg tgatctatgc ctgcgtgatg ggcctgcagt tcaagcaggc catgcacgag       180
     caggccgatg cgctgggcga aagcctgacc acgcagaccg ccacctccgc caccgagctg       240
     ctggtgtcca acgacatcct cagcctcaac gtgctgctca acaacctgac caagaacaag       300
     ctggtggccc acgccgccat ctacagcgtg gacaaccgca tcctggccga gtccggtcag       360
     cggcccaagc acggcctgct cggcgaagcc gagggcatgt acgagagcaa gatcaccttc       420
     caggacgtga ccgccgggca actgcgcatc agcctggaca tggatcagtt ccagcagccg       480
     atgaccatca gcctgcaaag catgggcatt ctgagtgcga tcctgctggc gctgtccctg       540
     gccctgagcc tgcgtctggg ccgacacatc tccacgccgc tgctgcaatt gcgtgtatgg       600
     ctgcgccgga tcgacgaata cacgccgggg atcgagcgtc aggacgagat cggcgatctt       660
     gcccgccagt tgcacgccaa ctatgccccg gagccggctg aaccggagcc cgagccggaa       720
     cccgagttcg aggacgacga catcgagccg gaattcgaag tgcgcaacct gcgtgatccg       780
     agcttcgacg agagccgccc gatggccgcg cagaagcctg cgccacgcca tgtggtcagc       840
     accgttgaag acgacgatga cgaagacccg ttcgccgacc tgcgtgacga gtcgctgagc       900
     gaagctgcac aaccggcggt gcgccgaccg accccaagcg tgccgcaaca cacggcggtg       960
     ctggcggtac aactgggctc gcaggaacaa ctgcgccgtt tgccgcgtgc acgcctggaa      1020
     gagttgcagg atcgatatcg cgattgcctg gaccaggctg cctcgttgta tcagggcgaa      1080
     atcgaaaccc tgaacgacgg cagcacgctg atgctgttcc ataccgaaga cagcggcgac      1140
     gattacctga ccaatgccat ctgctgcggc gagctgctgc gggcgctggg ccaccagttg      1200
     cagatcgaag tcgccgacag cggcatcacc ctgcaattgc agctgggact gacccttggt      1260
     gacgaactgt tcggtctgag ccagatcgac ttgttgctga ccgattccgc ccaggacgcc      1320
     ctggccctgt cgcaacacag ccgcaacctg ctgctggtgg agcgcaagat cggtgacgac      1380
     gcgctgatcc gccaacgtgc acggatccgg ccgattgcca gccctgaggg ggcttgctgc      1440
     gtggagcggt tgatggagcc ttatccgtcg atgcttgagc ggcaactggc gcggatgcat      1500
     gagcgtcggg cctga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page