(data stored in ACNUC7421 zone)

EMBL: CP000094.PE509

CP000094.PE509       Location/Qualifiers
FT   CDS_pept        complement(592501..594039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72255"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ01"
FT                   /protein_id="ABA72255.1"
FT                   /translation="MANETNVPHVKPTTLDGWVKLLDSVRLPVPQDAHDRVCRAIRDDR
FT                   SSLRDIADLMQDSPALALSIIREANRHTHGNMTAPAENLEVAINRLGLARTEELLARLP
FT                   AEPAAQIPQALRQLQMISQHATQQANGFFASRLARLWQDIHWGSLLFLSPLWPLALTFP
FT                   QLLEEWEVRVIHKGESARVVEKQLFGVRLLKIGEALVQVWRLPVWVQQGYRLLLTEQRE
FT                   LVKVLRIARDVDHPLRQQNRLDDDPTLRRWLNQPANTVLLANGLALSAQQAWDSPHSER
FT                   WQFLTSLYLQISMDEVQQQLHQQAAVSARHHFMPDLWHPALSLLWPWGTRRLPAGMLPA
FT                   AAPSAEDLSQWRRQCAELLAVPSRFTNAMSLTVAARDALVASGMRRVMILMTDRGHANL
FT                   RVHQTSGLPKDAAALNFVVSQSSVLQRLLAQQAQVRITPDNNAQFSALLPPSLRALFRG
FT                   EHLFLRSLVNNGRVIMIVVADQGGGPFADITVQAFGKTAQCIEKALHSFSQRGQ"
     atggctaatg aaacgaacgt cccacacgta aagccgacca cactcgatgg ctgggtgaag        60
     ctgctcgaca gcgttcgtct gccagtgccg caagacgccc atgaccgggt ctgccgggcg       120
     attcgcgatg accgcagctc gctgcgcgac atcgccgacc tgatgcagga cagcccggcg       180
     ctggccctga gcatcatccg cgaagccaac cgccacaccc acggcaacat gactgcgcct       240
     gcggaaaacc tcgaagtggc gatcaatcga ctcggccttg cccgtaccga agaactgctc       300
     gcccgcctgc ccgccgaacc tgccgcgcaa atcccccagg ccctgcgcca gttgcagatg       360
     atcagccagc acgccacgca acaggccaac ggttttttcg ccagtcgcct ggcgcgactg       420
     tggcaggaca ttcattgggg cagcctgttg tttctgtcgc cgctgtggcc gttggcgctg       480
     acctttcccc aactgcttga agagtgggaa gtgcgggtta tccacaaggg tgaatcggcg       540
     cgagtcgtgg aaaagcagct gttcggcgtg cgcctgctga agatcggcga ggcgctggtg       600
     caagtctggc gtctgccggt ctgggtgcag caaggttatc ggctgctgct gaccgaacag       660
     cgcgaactgg tcaaagtcct gcgcattgcc cgcgacgtcg atcatccgtt gcgccagcag       720
     aatcgcctcg atgacgaccc gaccctgcgc cgctggctca accagccggc caacaccgtg       780
     ttgctggcca acggactggc actctcggcg caacaggcct gggacagtcc gcacagtgag       840
     cgctggcaat tcctgaccag cctctacctg caaatctcga tggacgaggt gcaacaacaa       900
     ttgcaccaac aggccgccgt cagcgctcgc catcatttca tgccggacct ttggcacccg       960
     gcgctttcgc tgctgtggcc gtggggtacc cgtcgccttc cagccggaat gctgccggct      1020
     gccgcgccgt ccgctgaaga cctgagccag tggcgccggc aatgcgccga actgctggcg      1080
     gtgccaagtc gcttcaccaa cgccatgagc ctgaccgtcg ccgcccgcga cgcgctggtc      1140
     gccagcggca tgcgtcgggt gatgatcctg atgaccgacc gcggccacgc caatctgcgc      1200
     gtccatcaaa cctccgggtt gccgaaggac gccgctgcgc tgaatttcgt cgtcagccag      1260
     agttcggtgc tgcaacgctt gctcgcgcag caggcgcaag tgcggatcac cccggacaac      1320
     aacgcccagt tttccgccct gctgccgccc tcgctgcgcg cccttttccg tggtgaacac      1380
     ctgttcctgc gttcactggt gaacaacggc cgggtgatca tgatcgtggt cgccgaccag      1440
     ggtggcggtc cgttcgccga catcaccgtc caagccttcg gcaaaaccgc gcagtgcatc      1500
     gagaaagccc tgcacagttt tagccagcgc ggccaatga                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page