(data stored in ACNUC7421 zone)

EMBL: CP000094.PE515

CP000094.PE515       Location/Qualifiers
FT   CDS_pept        complement(598543..599622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0517"
FT                   /product="putative iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72261"
FT                   /db_xref="GOA:Q3KIZ5"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIZ5"
FT                   /protein_id="ABA72261.1"
FT                   /translation="MSAITTDLPALAQSIKDWGRELGFQQVGISGLNLAEHEQHLQRWL
FT                   EAGYHGEMDYMGAHGSKRSHPEELVPGTLRVVSLRMDYLPGDTQMAQLLTKPEKAYISR
FT                   YALGRDYHKLIRKRVQQLADRIQSEIGPFGFRAFVDSAPVLEKAIAEQAGLGWIGKNTL
FT                   VLNRKAGSYFFLSELFVDLPLPVDEPHSTEHCGRCTACLDICPTNAFVGPYVLDARRCI
FT                   SYLTIELKNAIPEDLRPLIGNRVFGCDDCQICCPWNRFARPSGESDFKPRHNLDNAELA
FT                   ELFLWDEDKFLSSTEGSPLRRAGYERWLRNLAVGLGNAPSSIPVLEALKARREYPSELV
FT                   REHVEWALKQHADRQGASL"
     atgtccgcca tcaccacaga tctgcctgcc ctcgcccaat ccatcaagga ctggggccgc        60
     gagctgggct tccagcaagt cggcatcagc ggtctgaacc tggccgagca tgaacagcac       120
     ctgcaacgct ggcttgaggc cggctatcac ggcgaaatgg attacatggg cgcccacggc       180
     agcaaacgct cgcaccccga agagctggtg ccgggcacct tgcgcgtggt gtcactgcgc       240
     atggactacc tgccgggcga cacgcaaatg gcgcaattgc tgaccaaacc ggaaaaggcc       300
     tacatctcgc gttatgcctt gggccgcgat tatcacaagt tgatccgtaa gcgcgttcaa       360
     caactggcgg acaggattca atccgagatc ggcccgttcg gtttccgcgc cttcgtcgac       420
     agcgccccgg tgctggaaaa ggccatcgcc gaacaggccg gcctgggctg gatcggcaaa       480
     aacaccctgg tgctgaaccg caaggccggc agttacttct ttctcagcga actgttcgtc       540
     gacctgcccc tgccggtgga tgaaccccat agcaccgaac attgcggccg atgcaccgca       600
     tgcctcgaca tctgcccgac caacgctttc gtaggcccgt acgtgctgga cgcgcgacgc       660
     tgcatttcct acctgaccat cgaactgaag aacgccatcc ccgaagacct gcgaccgctg       720
     atcggtaacc gtgtgttcgg ctgcgacgat tgccagatct gctgcccgtg gaaccgcttc       780
     gcccgcccgt ccggcgaaag cgatttcaag ccacggcaca acctggacaa cgccgaactg       840
     gccgaactgt ttttgtggga tgaagacaaa ttcctcagca gcaccgaggg ttcaccattg       900
     cgccgtgcgg gatacgaacg ctggctgcgc aatctggcgg ttggattggg taatgcgcca       960
     tcgagcattc cagtgctgga agcgctcaag gcccggcgcg aatacccgtc agaactggtg      1020
     cgtgaacatg tggaatgggc gctgaaacaa cacgccgacc gtcaaggtgc gtcgttatag      1080
//

If you have problems or comments...

PBIL Back to PBIL home page