(data stored in ACNUC7421 zone)

EMBL: CP000094.PE516

CP000094.PE516       Location/Qualifiers
FT   CDS_pept        599686..601185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0518"
FT                   /product="putative carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72262"
FT                   /db_xref="GOA:Q3KIZ4"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIZ4"
FT                   /protein_id="ABA72262.1"
FT                   /translation="MPHTKDQLPDALYRAAQVRELDARLIAGGTPGFELMQRAAHATWR
FT                   ALVRQWPAANEMTVFAGHGNNAGDGYLVAALAHRAGWQVQVLAVGEPQRLKGDAAVAHA
FT                   EAVAEGVSIAAWDLSCELRGIVVDALLGTGLNGEVREPYAAAIAAINASGLPVVAVDIP
FT                   SGLCADTGHALGDAVHADLTVTFIGLKLGLFTGAAADHVGELRFNDLQATAENFSDIPA
FT                   AAQRLSAINLPRLAARAPAAHKGRFGHVLLIGGDHGFGGAILLSTESALRSGAGMVSVA
FT                   TRPEHVPAALSRVPEAMVLGTSSANQLMGLLEKVSVLVVGPGLGQAAWGRALLSAAANA
FT                   SLPQVWDADALNLLARGFVSLPKDCVITPHPGEAARLLGISTAEVQADRPAAALALSKK
FT                   YTAVVVLKGAGSLIAHPDGRLALCHQGHPAMATAGLGDVLAGLIGALLAQGMDGFDAAC
FT                   LAVWLHASAGAQQGKFGRGLAASDLIPAIRQLLEEHAPCLK"
     atgccgcaca ctaaagatca attacccgac gcactgtacc gtgccgcgca ggtgcgcgaa        60
     ctcgatgcac ggctgatcgc cgggggcacg ccgggcttcg aattgatgca gcgtgccgcc       120
     catgccacat ggcgcgcgct ggtgcgccaa tggccggccg cgaatgaaat gacggtgttc       180
     gcagggcacg gcaacaacgc cggcgatggt tatctggtgg cggcgctggc ccaccgggcg       240
     ggttggcagg ttcaggtgct ggctgtcggt gagccgcagc gtttaaaggg cgatgctgcc       300
     gtggcgcacg ccgaagccgt ggccgagggt gtctcgattg cagcatggga tctgtcctgc       360
     gagttgcgcg gcatcgtcgt tgacgcgttg ctcggcaccg gcctgaacgg cgaagtgcgt       420
     gagccttacg ccgctgcgat tgcggcgatc aatgccagcg gactgccggt ggtggcggtc       480
     gatattcctt ccgggttgtg cgccgatacc ggtcatgcgc tgggtgatgc agtgcacgcc       540
     gacctcaccg tgacttttat cgggctgaaa ctcgggctgt tcacgggtgc ggcggcggat       600
     cacgtcggcg aactgcggtt taacgatctg caggccacgg ccgaaaactt cagtgacatt       660
     cctgctgccg ctcaacggct cagcgcgatt aacctgccgc gtctggcggc ccgcgcgccg       720
     gcggcgcaca aggggcgttt cggccatgtg ctgctgatcg gcggcgatca cggttttggc       780
     ggggcgattc tgctgagcac cgaaagcgcg ttgcgcagtg gtgccgggat ggtctcggtc       840
     gcgactcgcc cggaacatgt gccagcggcg ttgagccggg tgccggaagc catggtgctg       900
     ggtacttctt cggccaatca gttgatgggg ctgctggaaa aggtgtcggt gctggtggtc       960
     gggccgggac tggggcaggc cgcttgggga agggcgctgt tgtcggccgc tgccaatgcc      1020
     tcgctgccgc aggtgtggga tgccgatgcg ctgaacctgc tggcccgcgg ttttgtcagt      1080
     ttgcccaagg attgcgtgat cacgccgcat ccgggggaag cagcgcgttt attggggatc      1140
     agtaccgccg aagtgcaggc tgatcgtccc gcggcggcgc tggcgttgag caaaaaatat      1200
     acagcggtgg tggtgctcaa gggcgcgggc agtctgattg ctcatcccga tggtcgtctg      1260
     gcgctttgtc atcaaggcca tccggccatg gccactgccg ggctcggcga tgtgctggcg      1320
     ggcctgatcg gcgcgctgct ggcccagggc atggacggtt tcgatgccgc gtgtctggcg      1380
     gtctggctgc acgccagcgc cggggcgcaa caaggtaaat tcggccgtgg gctggcggcc      1440
     agtgatctga ttccagccat tcgtcagttg ttggaggagc atgcaccgtg tctgaagtaa      1500
//

If you have problems or comments...

PBIL Back to PBIL home page