(data stored in ACNUC7421 zone)

EMBL: CP000094.PE521

CP000094.PE521       Location/Qualifiers
FT   CDS_pept        606049..606309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0523"
FT                   /product="Hfq protein (host factor-I protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72267"
FT                   /db_xref="GOA:Q3KIY9"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIY9"
FT                   /protein_id="ABA72267.1"
FT                   /translation="MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPVRPIRLPSATESEAGDAEPGNA"
     atgtcaaaag ggcattcgct acaagaccct tacttgaata ctttacgtaa agagaaagtg        60
     ggggtttcca tctacctggt gaacgggatc aaactgcaag gcacgatcga atcgttcgac       120
     cagttcgtta tcctgctgaa gaacaccgtc agccagatgg tttacaaaca cgctatctct       180
     acagtcgtgc cggttcgtcc aattcgtctg ccaagcgcaa ccgaatccga agcaggtgac       240
     gctgagccag gtaacgcctg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page