(data stored in ACNUC7421 zone)

EMBL: CP000094.PE523

CP000094.PE523       Location/Qualifiers
FT   CDS_pept        607720..608889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0525"
FT                   /product="protease FtsH subunit HflK"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72269"
FT                   /db_xref="GOA:Q3KIY7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIY7"
FT                   /protein_id="ABA72269.1"
FT                   /translation="MAWNEPGGNSNNQDPWGGKRRNNGDRKGPPDLDEAFRKLQESLNG
FT                   LFGGGKKRGDDGGGSGKSGGFGGLLGIGLVVLAAVWLYSAVYVVDEQEQAVVLRFGKYY
FT                   ETVGPGLNIYFPPIDKKYMENVTRERAYTKQGQMLTEDENIVEVPLTVQYKISNLQDFV
FT                   LNVDQPEISLQHATDSALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITV
FT                   TQVNVQSAAAPREVQEAFDDVIRAREDEQRSRNQAETYANGVVPEARGQAQRILEDANG
FT                   YRDETVSRAKGEADRFTKLVAEYRKAPEVTRQRLYLDTMQEVFSSTSKVLVTGNKNGQS
FT                   NLLYLPLDKMIQNSSGSNAPVTGSAAASNNTDATPHVTDLPQSRTRETR"
     atggcttgga atgagccggg tggcaactcg aacaatcagg atccttgggg tggcaagcgt        60
     cgcaacaacg gcgaccgcaa gggaccgccg gatctcgacg aggccttccg aaagctgcag       120
     gaaagcctga acgggttgtt cggtggtgga aaaaaacgcg gtgatgacgg tggtggctcg       180
     ggcaagagcg gcggcttcgg cggcctgctc ggcatcggcc ttgtcgtgct ggcggccgtc       240
     tggctgtaca gcgcggtgta tgtcgtggac gagcaggagc aagccgtggt gctgcgcttc       300
     ggcaagtact acgagactgt cggtcccggc ctgaacatct acttcccgcc gatcgacaag       360
     aagtacatgg agaacgtcac gcgtgagcgt gcctacacca agcagggcca gatgctgacc       420
     gaagacgaga acatcgtcga agtgccgctg accgtgcagt acaagatcag caacctgcag       480
     gacttcgtgc tgaacgtcga ccagccggaa atcagcctgc aacatgcgac cgacagtgcg       540
     ctgcgccatg tggtgggctc caccgcgatg gaccaggtgc tgaccgaagg tcgtgagctg       600
     atggccagcg agatcaagga gcgcctgcag cgcttcctcg atacctatcg caccggtatc       660
     acggtcaccc aggtcaacgt acagagcgca gcggcaccgc gtgaagtgca ggaagccttc       720
     gatgacgtga tccgcgcccg tgaagacgag cagcgttcgc gcaaccaggc tgaaacctac       780
     gccaacggcg tggtgccgga agcccgtggt caggcccagc gtatcctcga agatgccaac       840
     ggttaccgtg acgaaacggt ctcgcgcgcc aagggtgagg cggatcgctt caccaaactg       900
     gttgccgagt atcgcaaggc gcccgaggtc actcgtcagc gtctgtacct ggacaccatg       960
     caggaagtct tcagcagcac cagcaaggta ctcgtgaccg gcaacaagaa cggccagagc      1020
     aacctgcttt acctgccgct ggacaagatg attcagaaca gttcgggcag caatgcaccg      1080
     gtcaccggtt cggctgccgc cagcaacaac acggacgcta cgccgcatgt cactgacctg      1140
     ccacagtcgc gtacaaggga gacccgctga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page