(data stored in ACNUC7421 zone)

EMBL: CP000094.PE525

CP000094.PE525       Location/Qualifiers
FT   CDS_pept        610072..611259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0527"
FT                   /product="putative ATP phosphoribosyltransferase regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72271"
FT                   /db_xref="GOA:Q3KIY5"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIY5"
FT                   /protein_id="ABA72271.1"
FT                   /translation="MATVDRWLLPDGIEEVLPPEAARIEVARRQVLDLFQSWGYEFVVT
FT                   PHIEYLESLLTGAGQDLDLRTFKVIDPQSGRQMGFRADITPQVARIDAHTLRREGPSRL
FT                   CYAGSVLHAQPRALSSSRSPIQLGAELYGDASPSSDVEVISLMLAMLQLADVPDVHMDL
FT                   GHVGIYRGLAQAAGLSGEVEQQLFDALQRKAIDEVITLTEGLPADLSGMLRALVDLCGG
FT                   REVLSAARERLANAPAPVLAALEDLLAIAERLSVRFPELPLYFDLGELRGYHYHTGVVF
FT                   AVFVPGVGQSIAQGGRYDDIGADFGRARPATGFSTDLKTLVTLGRAEIELPSGGIWMPD
FT                   STDAALWQQVCQLRSEGQRVVQALPGQPLAAARDADCDRQLIQQNGLWQVSPLAS"
     atggcaacgg tagaccgctg gctgctgcca gatggcatcg aagaagtact gccaccggaa        60
     gcggcgcgca ttgaagtcgc gcgtcgtcag gtgttggatc tgttccagag ctggggttac       120
     gagttcgtcg tgactcccca tatcgagtac ctggaatccc tgctgaccgg cgcgggccag       180
     gacctggatc tgcgtacctt caaggtcatc gacccgcaat cgggccggca gatgggtttc       240
     cgtgccgaca tcacgccgca agtggcgcgc atcgatgcgc acaccctgcg tcgcgaaggc       300
     ccgagccgtc tgtgctacgc cggcagcgtc ctgcatgccc agccgcgtgc cttgtcgtcc       360
     tcgcgcagcc cgatccagtt gggcgccgag ttgtacggcg atgccagccc gagcagcgac       420
     gtcgaagtca tcagcctgat gctggccatg ctgcaactgg ccgacgtgcc ggacgtgcac       480
     atggacctcg ggcatgtcgg catctaccgc ggtctggccc aggcggccgg tctgtcgggt       540
     gaagtcgagc agcagttgtt cgatgcgttg caacgcaagg ccatcgacga ggtcattacc       600
     ttgaccgaag gcctgccggc cgatctgtcc ggcatgttgc gcgcgctggt cgacctgtgc       660
     ggcggccgtg aagtactgag cgctgcccgc gagcgtctgg ccaatgcgcc ggcgccggta       720
     ctggcggcgc tggaagattt gctggcgatc gccgagcgtc tgtcggtgcg cttcccggag       780
     ctgccgctgt acttcgacct cggcgagctg cgcggctatc actaccacac cggtgtggtg       840
     ttcgcggtgt tcgtgccggg tgttggccag tccatcgccc agggcggtcg ctacgacgac       900
     atcggcgccg acttcggtcg cgcccgtccg gccaccggct tctccaccga tttgaaaacc       960
     ctggtgaccc tggggcgtgc tgagatcgag ctaccgtctg gcggtatctg gatgcctgac      1020
     agtacggatg cggcactctg gcagcaggtt tgccagttgc gcagtgaggg tcagcgtgtc      1080
     gttcaggcgt tgcctggaca acctttggcc gccgcccgtg atgcggactg cgaccggcaa      1140
     ttgatccagc agaacgggct ttggcaagta tcgccactgg cttcttga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page