(data stored in ACNUC7421 zone)

EMBL: CP000094.PE527

CP000094.PE527       Location/Qualifiers
FT   CDS_pept        612657..614678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0529"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72273"
FT                   /db_xref="GOA:Q3KIY3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIY3"
FT                   /protein_id="ABA72273.1"
FT                   /translation="MPVGRHDLCCDSVYKSAIKLMASEVEGFKVSAVLSLLQSRLLRPV
FT                   FVTLGIALLVQVLVAVALTRSTVTALEADLGTRLGADSQKLSGELEQAGREVTSSLDNL
FT                   SSSTRQRLTAGLSSRLKEEQAQLRATLEKDLKDSANDMAQLLASVAPRAMWDSDVPTLS
FT                   EFARRAQRNPNVLFVVYDDATGQHLTRYLNRENPINKALLEKGQGERALDKVLDAAKND
FT                   PSVYYLEASINPNGVEIGKVLMGVSTASVETDLAALDQRFSALIASSDQLVGDSLKGAA
FT                   ADSATAMQARLQSAQSTAAEMKANTTSTVQDAAATLRWRIGMGLALVGAGVLLLLAVVL
FT                   GHRVVNRLKMLNAAMDDLAAGEGDLTKRVQINSKDEIGDMASAVNRFVDKLQPIVREAG
FT                   DVAQRTGVEIGAMTLRNAGADAAAGMQRDEVAESLRALSQMADEAQSESHAMQAALKQV
FT                   VDIRQATDENTRTSAKVGSLIEALAGQVDTGAKVIERLAQQSEQIEVVLTVIHGIAEQT
FT                   NLLALNAAIEAARAGETGRGFAVVADEVRALASKTQSSTGDIQAHIVALQQGAREAVEA
FT                   IGQAGRQASEGLLVLRDSARLQQSVQASVEQVHAAIGLATQAAAHQAQGAQAVRGRVET
FT                   IHAQAEKAAQAVVETTASGKVLDGLAAQLKASLGQFRA"
     atgcctgttg gacggcatga cctttgctgt gattctgtct acaagagtgc catcaaatta        60
     atggcgtcag aagtagaggg attcaaagtg tcagccgttc tctcactgtt acaaagccgt       120
     ttgttgcggc ctgtgttcgt tacccttggt atcgcccttt tggtgcaggt gctggtggcc       180
     gtcgccctga cgcggagcac cgtcaccgcg ctggaggccg atctcggcac tcgcctgggc       240
     gccgacagcc agaagttgtc aggtgagctg gagcaggccg ggcgtgaagt cacgtcgagt       300
     ctcgacaacc tctcctcgag tacccgtcag cgtcttaccg ccggtctttc ctcgcgtctg       360
     aaggaagagc aggcgcagct gcgtgcgacg ttggaaaaag acctgaagga ttcagccaat       420
     gacatggccc agttgctggc ctcggtggcg ccccgtgcca tgtgggacag cgacgtgccg       480
     accctgtccg aattcgcccg tcgggcccag cgcaatccca acgtgctgtt tgtggtgtat       540
     gacgacgcca ccggccagca tctgacccgc tacctcaacc gcgaaaaccc gatcaacaag       600
     gcccttttgg aaaaaggcca gggcgagcgg gcgctggaca aggtgctgga tgcggcgaag       660
     aacgatccgt cggtctacta cctggaagcc tcgatcaacc ccaatggcgt ggagatcggc       720
     aaggtgttga tgggcgtctc caccgcttcg gttgaaaccg atctggcggc gctcgaccag       780
     cgcttctcgg cgttgattgc cagcagcgat caactggtcg gcgacagtct caaaggtgct       840
     gctgccgaca gtgccaccgc catgcaggct cgcctgcaat cggcgcagtc cacggctgcc       900
     gagatgaaag ccaacaccac cagtaccgtg caggatgctg ctgcaacgct gcgttggcgc       960
     atcggcatgg gcctggcgct ggtcggggct ggggtgctgt tgctgctggc cgtggtgctc      1020
     ggtcatcggg tcgtcaatcg tctgaaaatg ctgaatgccg ccatggatga tctggcagca      1080
     ggcgagggcg atctgaccaa gcgcgtgcag atcaacagca aggacgagat cggcgacatg      1140
     gcgtcggcgg tcaaccgctt tgtggacaag ttgcagccga tcgtgcgcga ggccggggat      1200
     gtggctcagc gtaccggtgt ggaaatcggc gccatgaccc tgcgcaacgc cggtgccgat      1260
     gcggcggccg ggatgcagcg tgatgaagtg gccgaaagtc tgcgggcgct gtcgcaaatg      1320
     gccgatgaag cgcaatcgga aagccatgcg atgcaggccg cgttgaagca ggtggtggat      1380
     attcgccagg ccaccgacga gaacactcgc acctcggcca aggtcggcag cctgatcgag      1440
     gcgctggcgg ggcaggtcga taccggggcg aaagtcatcg agcggctggc gcagcagagc      1500
     gagcagatcg aggtggtgct gacggtgatt cacggcatcg ccgagcagac caacctgctg      1560
     gcgctcaacg cggccattga agcggcccgt gctggtgaga ccggtcgcgg gtttgcggtg      1620
     gtggcggatg aggtccgggc gctggcgagc aagacccaaa gctccaccgg cgatattcag      1680
     gcgcacatcg tggccttgca gcagggcgcc cgtgaagcgg tcgaggcaat cggtcaggcc      1740
     gggcgtcagg ccagcgaagg cttgctggtg ctgcgtgaca gtgcgcgttt gcagcagtcg      1800
     gtgcaggcgt cggtcgagca ggtgcatgcg gcgattggcc tggcgactca ggccgcggcg      1860
     catcaggcgc aaggcgcgca agctgtgcgt gggcgcgtcg agacgattca tgcccaggcc      1920
     gagaaagccg ctcaggccgt ggtcgagacc acggccagcg gcaaggtgct ggatggtctg      1980
     gcggcgcagc tcaaggccag tctggggcag ttccgggcct ga                         2022
//

If you have problems or comments...

PBIL Back to PBIL home page