(data stored in ACNUC7421 zone)

EMBL: CP000094.PE528

CP000094.PE528       Location/Qualifiers
FT   CDS_pept        complement(614720..616285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0530"
FT                   /product="iron(III)-transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72274"
FT                   /db_xref="GOA:Q3KIY2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIY2"
FT                   /protein_id="ABA72274.1"
FT                   /translation="MTASLSAPATRGGYVPRRKRPSIWLVLPVLLLVVMSLLPLAYVGL
FT                   KAWQAGWSEALHLLWRPYVFSLLRNTLALMVGVTVTCGVIGLSLAWLLERSNLPGRQLW
FT                   GVILCLPFAVPAFVSSFTWVSLSAQFEGLGGAILVMSLSKYPLIFLPVAATLRNLDPSL
FT                   EESARTLGQNRWGVFFRVTLPLLWPSLLAGSLLIALHMLVEFGALSIIGLQTFTTAIYQ
FT                   QFELEFSNANAAMLSAVLLALCLMLLWLELRVRGKGRHVRTGQGAARRAEQVRLGPWAI
FT                   AGQLYCLMLAIVGSGIPLGMLAYWLAVGSSAAFPVAAITEALLSSLALSLGGAGLCLVL
FT                   AVPVGLLVVRYKGQLAIWAERLPYLLHALPGLVIALTLVYFALHYVPALYQTSALLLIA
FT                   YALLFLPLAQAPIRTALNKAAPQLEEAARTLGASSFTAFCRVTLPIIFPALGAAFALVF
FT                   LDAMKELTATLLLSPTGLNTLATEVWAHTANVEFAAAAPYAALLIVVSGLPVYLLTTRM
FT                   YLSR"
     atgactgcat cgttatccgc ccccgctaca cgcgggggtt atgtgccacg acgcaagcgg        60
     ccgtcgatct ggctggtgct gccagtgttg ctgctggtgg tcatgagcct gttgccgctg       120
     gcctacgtcg ggctcaaagc ctggcaagca ggctggtccg aggcgctgca cttgctgtgg       180
     cgcccgtatg tgttcagcct gctgcgcaac acgctggcgc tgatggttgg cgtgaccgtg       240
     acttgcggtg tgatcggcct gtcgctggcc tggctgttgg agcgcagcaa tctgccgggc       300
     cgacagctgt ggggcgtgat tctttgcctg ccgttcgcgg tgccggcatt tgtcagcagc       360
     ttcacctggg tttcgctcag cgcgcagttc gaaggactcg gcggggcgat tcttgtgatg       420
     agcctgtcga aatacccgct gatctttctg ccggtggccg ccacactgcg caatcttgat       480
     ccctcccttg aagaatcggc acggacgctg ggtcagaatc gctggggcgt gtttttccgc       540
     gtcacccttc cactgctctg gccttcgctg ctggccggtt cgctgctgat tgcgctgcac       600
     atgctggtgg aattcggcgc actgtcgatc attggcctgc aaacctttac caccgcgatc       660
     tatcagcaat tcgaactgga attcagcaat gccaacgcgg cgatgctgtc ggcggtattg       720
     ctggcgctgt gcttgatgct gttgtggctg gagctgcgcg tgcgcggcaa gggccggcac       780
     gtacgcaccg gccagggtgc ggcgcgtcga gctgaacaag tgcgactggg cccttgggcg       840
     atcgccggtc agttgtattg cctgatgctg gcgattgttg gcagcgggat cccactgggc       900
     atgctggcct actggcttgc cgtgggatcg tcagcagcct tcccggtggc ggcaatcacc       960
     gaagcattgc tgtcatcgct ggctctatcg ctgggcggcg caggattgtg cctcgtgctg      1020
     gcggtgccgg tcggattgct ggtagtgcgc tacaaaggcc aactggcgat ctgggccgag      1080
     cgcctgccct atctgctgca cgccctgccg ggattggtga tcgcattgac gctggtgtat      1140
     ttcgccctgc attacgtgcc ggcgctgtac cagacctccg cgctgttgct gatcgcctat      1200
     gcgctgctgt ttctgcctct ggctcaggca ccgatccgca cggcgctgaa caaggcggca      1260
     ccgcaacttg aagaagccgc ccgcaccctc ggcgcctctt cgttcacggc gttctgccgg      1320
     gtgactctac cgatcatctt cccggcactg ggcgcagcgt ttgcgctggt atttctggat      1380
     gccatgaagg aactgacggc gacgttgctg ctgagcccca cagggctcaa cacattggcg      1440
     acggaagtct gggcacacac cgcgaatgtc gagttcgcag cggcggcgcc ttatgcggcg      1500
     ttgttgattg tggtgtcggg attgccggtg tatctgctga cgacccggat gtatttgagc      1560
     cgataa                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page