(data stored in ACNUC7421 zone)

EMBL: CP000094.PE529

CP000094.PE529       Location/Qualifiers
FT   CDS_pept        complement(616285..617295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0531"
FT                   /product="putative iron-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72275"
FT                   /db_xref="GOA:Q3KIY1"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIY1"
FT                   /protein_id="ABA72275.1"
FT                   /translation="MMFRNTLRRGLTFTLLGLALAPPLTQAADAVSLTLYNGQHKEVGD
FT                   AIAKAFEAKTGIHVNVRKGSSNQLASQIIEEGDRSPADVIYTEESPPLNNLGEQGLLAK
FT                   ADDATLAVLPKEYVAGNGTWIGVTARVRVVAFNPKLIDEKDLPKSVLDFADPQWQGKVG
FT                   FVPTSGAFQEQAVAIIKKHGREAAEEWLTGLRAFGKTYSNNMVALKAVENGEVATVLVN
FT                   NYYWFALQREKGKLDSKLHYFTGGDVGGLITVSSAAVLKSSKHPKEAQQFLAYMASEEG
FT                   QRVITQTTAEYPLHKGMESDRGLKPFSELEAPDVTPADLGNAEEALELEREVGLN"
     atgatgtttc gaaataccct gcgccgcggc ttgaccttca ccctgctcgg cctggcactc        60
     gccccccccc tcacccaggc tgccgacgcg gtttccctga cgctctacaa cggtcaacac       120
     aaggaagtcg gcgacgcgat cgccaaagcc ttcgaagcca agaccggcat tcacgtcaac       180
     gtgcgcaagg gcagcagcaa tcagctggcc agccagatca tcgaagaagg cgaccgctcc       240
     cccgccgacg tcatctacac cgaagaatcc ccaccgctga acaacctcgg cgaacaaggt       300
     ctgctggcca aggctgacga cgcgaccctg gccgttctgc cgaaagaata tgtcgccggc       360
     aacggcacct ggatcggagt gaccgcccgg gttcgcgtgg tggccttcaa cccgaaactg       420
     atcgacgaaa aagatttgcc gaaatcggtg ctggatttcg ccgatccgca gtggcaaggc       480
     aaggtcggtt tcgtaccgac cagcggcgcg ttccaggaac aagccgtggc gatcatcaaa       540
     aagcacggcc gcgaagccgc cgaagaatgg ctgaccggcc tgcgcgcatt cggcaagacc       600
     tacagcaaca atatggtcgc cctcaaggct gtggaaaacg gcgaagtcgc cacggtgctg       660
     gtaaacaact attactggtt cgccctgcag cgagagaaag gcaagcttga ttccaaactg       720
     cattacttca ccggtggtga cgttggcggc ctgatcaccg tgtccagcgc agccgtgctg       780
     aaatccagca aacatccaaa agaagcccag caattcctcg cctacatggc cagcgaagaa       840
     ggccagcgcg tgatcaccca gaccaccgcc gagtacccgc tgcacaaagg catggaatcg       900
     gatcgcggtc tcaagccgtt cagtgaactg gaagcaccgg acgtcacgcc ggccgacctg       960
     ggcaacgccg aagaagcgct ggagctggaa cgcgaagttg gcctgaactg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page