(data stored in ACNUC7421 zone)

EMBL: CP000094.PE532

CP000094.PE532       Location/Qualifiers
FT   CDS_pept        621769..622197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0534"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72278"
FT                   /db_xref="GOA:Q3KIX8"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIX8"
FT                   /protein_id="ABA72278.1"
FT                   /translation="MRHYEIIFLVHPDQSEQVGGMVERYTKLIEEDGGKIHRLEDWGRR
FT                   QLAYAINNVHKAHYVMLNVECTGKALAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLK
FT                   AEENRSERRERRERPEHDGSADGDDSDSDSDNSDNADE"
     atgcgtcatt acgaaatcat ctttctggtc caccctgacc agagcgagca agtcggcggc        60
     atggttgagc gttacaccaa gctgatcgaa gaagacggcg gcaaaatcca ccgtctggaa       120
     gactggggcc gtcgtcaact ggcctacgca atcaacaatg ttcacaaggc tcactacgtg       180
     atgctgaacg ttgagtgcac cggcaaggcc ctggccgagc tggaagacaa cttccgctac       240
     aacgatgctg tgatccgtaa cctggtcatc cgtcgcgacg aagccgttac cggccagtcc       300
     gagatgctca aggctgaaga aaaccgcagt gagcgccgtg agcgtcgcga acgtcctgag       360
     cacgatggca gcgccgatgg cgatgacagc gatagcgaca gcgacaacag cgataacgct       420
     gacgagtaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page