(data stored in ACNUC7421 zone)

EMBL: CP000094.PE533

CP000094.PE533       Location/Qualifiers
FT   CDS_pept        622226..622456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0535"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72279"
FT                   /db_xref="GOA:Q3KIX7"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIX7"
FT                   /protein_id="ABA72279.1"
FT                   /translation="MARFFRRRKFCRFTAEDVKEIDYKDLNTLKAYVSETGKIVPSRIT
FT                   GTKARYQRQLATAIKRARFLALLAYTDSHGR"
     atggcacgtt tcttccgtcg tcgtaaattc tgccgcttca ccgctgaaga cgtgaaggag        60
     atcgattaca aagatctcaa cactctgaaa gcctacgtat ccgagaccgg caaaatcgtt       120
     ccaagccgca tcaccggtac caaagctcgt tatcagcgtc agctggccac cgctatcaag       180
     cgcgcccgct tcctggccct gctggcctac accgacagcc acggccgctg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page