(data stored in ACNUC7421 zone)

EMBL: CP000094.PE540

CP000094.PE540       Location/Qualifiers
FT   CDS_pept        634088..636574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72286"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIX0"
FT                   /protein_id="ABA72286.1"
FT                   /translation="MPDLLDRYPLTAGTYHELLDDSGAVRPHWRRLVDQLQRSTPAQLV
FT                   QRQALLTRQIQENGVTYNVYADPKGADRPWELDLLPHVIAADEWQQLSAGIAQRARLLN
FT                   AVLADLYGPQQLIREGLLPAELVFGHNNFLWPCQGIAPPDGAFLHLYAVDLARTPDGRW
FT                   WVTADRTQAPSGAGYALENRTIVSRAFPELYRDLKVQHLAGFFRTLQETLAHQAPCDDD
FT                   APLVVLLTPGRFNESYFEHLYLARQLGYPLVEGGDLTVRDATVYLKTLSGLRRVHAIMR
FT                   RLDDDFCDPLELRTDSALGVPGLLEAVRQGRVLVANALGSGVLESPGLLGFLPKINQYL
FT                   FGEELILPSIATWWCGEAPVLAQALEKLPELLIKPAFPSQSFTPVFGRDLSEKQRESLA
FT                   ARMQARPYAYVAQELAQLSQAPIWQPEDGQLQPRAIGMRMYAVASHDGYRVLPGGLTRV
FT                   AAEADAEVVSMQRGGASKDTWVLGDRPPSGEQWKAQRNIGVPDLVRRDPYLPSRVVENL
FT                   FWFGRYCERCDDSARLLRIMLARYVDGDDPQALQAAVDLGERLMLLPDEGELPERLLAA
FT                   LLGEDWSFSLRSNLQRLQWAASQVRGKLSRENWQALVELQREASELDTDEPDFGELLDF
FT                   LNRLVMSLAALSGFALDDMTRDEGWRFLMIGRRIERLQFLSSSLAGFLRGAGAFDQAGL
FT                   EWLLELGNSSITYRSRYLAVAQLIPVLDLLLLDEQNPHAVLFQLKLVTRTLKRLNDDFG
FT                   VPREAGLPTLVERLARFDLSCLENPLFGEPSVRAALDGLADLLQEIADASSQVSDRLAL
FT                   RHFAHVDDVSQRTVSV"
     atgcctgacc tgcttgaccg ctacccgctg acggcgggca cctatcacga actgctcgac        60
     gacagcgggg cggtgcgccc gcactggcgg cgactggtcg accaattgca gcgcagcacc       120
     ccggcgcaac tggtgcagcg tcaggcgttg ctgacccggc agattcagga aaacggtgtc       180
     acctacaacg tctatgccga ccccaagggg gcggaccgtc cgtgggaact ggatctgctg       240
     ccccacgtga tcgccgctga cgagtggcaa cagctgtctg ccggaatcgc ccagcgcgcg       300
     cggctgctca atgcggtgct ggcggacctg tatggcccgc agcagttgat ccgcgaaggc       360
     ttgttgccgg cggagctggt gttcggccac aacaactttc tctggccctg tcagggcatt       420
     gcgccgccgg acggggcctt tctgcatctg tatgccgtgg atctggcgcg cacgccggac       480
     ggacgctggt gggtgacggc ggatcgcact caggcgccat cgggggccgg gtatgcgctg       540
     gaaaatcgca ccatcgtgtc ccgcgccttc cccgagttgt accgggatct gaaggtgcaa       600
     catctggccg gcttcttccg caccctgcag gaaactctgg cccatcaggc cccgtgcgac       660
     gatgacgcgc cgctggtggt gctgctgacc ccggggcgtt tcaacgaaag ctatttcgaa       720
     catctttatc tggcgcgcca gctcggttat ccgctggtgg agggcggtga cctgacggtg       780
     cgtgatgcca cggtctacct gaaaaccctc agtggcctgc gccgggtgca cgcgatcatg       840
     cgccgcctcg acgatgactt ctgcgatccg ctggaattgc gtacggattc ggcgctgggc       900
     gttcccggac tgctggaggc ggtgcgtcag ggccgggtgc tggtggccaa tgcgctgggc       960
     agtggcgtac tggagtcgcc ggggctgctg gggttcctgc cgaagatcaa tcagtacctg      1020
     ttcggtgaag agctgatcct gccgtccatt gccacgtggt ggtgcggcga agcgccggtg      1080
     ctggcccagg ccctggaaaa attgccggag ctgctgatca aaccggcgtt cccgtcgcaa      1140
     agctttacgc cggtatttgg tcgggatctg agcgaaaaac agcgtgaaag tctcgccgcg      1200
     cgcatgcagg cacggcctta tgcgtatgtc gcgcaagaac tcgcgcagct gtcccaggcg      1260
     ccgatctggc agcccgagga cgggcaactg caaccccggg caatcggcat gcgcatgtac      1320
     gcggtggcca gtcacgacgg ttatcgggtg ctgcccggtg gcctgacccg ggtcgcggcc      1380
     gaagccgatg ccgaagtggt gtcgatgcag cgcggtggcg cgagcaagga cacctgggtg      1440
     ctgggggatc gaccgccgag cggggaacag tggaaagccc agcgcaatat cggcgtgcct      1500
     gatctggtgc ggcgcgatcc gtacctgccg tcgcgggtgg tggagaatct gttctggttc      1560
     ggccgttact gcgagcgctg tgacgacagc gcgcggttgt tgcggatcat gctggcgcgg      1620
     tacgtcgacg gtgatgatcc acaggccttg caggccgctg tggatctggg cgagcggctg      1680
     atgctgctgc cggatgaagg tgaacttccg gaacgcttgc tcgcggcact gctcggcgag      1740
     gactggtcgt tcagcctgcg ctccaacctg cagcgcttgc agtgggcggc ttcgcaggtg      1800
     cgcggcaagt tgtcccggga aaactggcag gcgctggtgg agttgcaacg tgaggcttcg      1860
     gaacttgaca ccgacgaacc ggacttcggc gagctgctgg attttctaaa ccggctggtg      1920
     atgtcgctgg cggcgctgtc cgggtttgcc ctcgacgaca tgacccgtga cgaaggctgg      1980
     cgcttcctga tgatcggccg gcgcatcgaa cgcctgcaat ttctcagcag cagccttgcg      2040
     ggttttctgc gcggcgccgg ggcgttcgat caggccgggc ttgagtggtt gctggagctg      2100
     ggcaacagca gcatcaccta tcgctcgcgt tatctggcag tggcgcagtt gattccggtg      2160
     ctcgacctgt tgctgctgga tgagcagaac ccccatgcgg tgttgttcca gttgaaactt      2220
     gtgactcgca ccctcaagcg tttgaatgat gacttcggag tgccgaggga ggcaggattg      2280
     ccgacgctgg tcgagcgtct ggcgcgtttc gacttgagct gtctggagaa tcctttgttc      2340
     ggcgaaccca gcgtgcgcgc ggccctcgac ggtctggcgg atctgctgca ggagatcgcc      2400
     gacgccagca gtcaggtgtc ggatcgtctg gccctgcgcc atttcgccca tgtcgatgat      2460
     gtcagccagc gcacggtgtc cgtctga                                          2487
//

If you have problems or comments...

PBIL Back to PBIL home page