(data stored in ACNUC7421 zone)

EMBL: CP000094.PE551

CP000094.PE551       Location/Qualifiers
FT   CDS_pept        647107..648021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0553"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72297"
FT                   /db_xref="GOA:Q3KIV9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV9"
FT                   /protein_id="ABA72297.1"
FT                   /translation="MDGIFLQQLVNGLTLGSVYGLIAIGYTMVYGIIGMINFAHGEVYM
FT                   ISAYLAAISLALLAYFGIESFPLLMLGTLIFTIVITAVYGWVIERVAYKPLRNSTRLAP
FT                   LISAIGISLILQNYAQIAQGAKQQGVPTLLTGAWRVEVGTGFVQLTYTKVFILVAAFVG
FT                   MGLLTYVIKYTKLGRMCRATQQDRKMASILGINTDRVISYVFIIGAAMAALAGVLITMN
FT                   YGTFDFYAGFIIGIKAFTAAVLGGIGSLPGAMLGGIILGISESLFSGLVNSDYKDVFSF
FT                   SLLVLVLVFRPQGLLGRPLVSKV"
     atggatggta ttttcctgca gcaactggtc aacggcctga ccctcgggtc ggtctatggc        60
     ctgatcgcca tcggctacac aatggtctac ggcatcatcg gcatgatcaa cttcgcccac       120
     ggcgaggttt acatgatttc tgcttacctg gcggcaatca gtctggctct gctggcttac       180
     ttcggtattg aatccttccc gctgctgatg cttggcaccc tgatattcac catcgtgatc       240
     acggcggtgt atggctgggt catcgagcga gtcgcttaca aacccctgcg caactccacc       300
     cgactggcac cgttgatcag cgccatcggc atctccctga ttctgcaaaa ctacgcacag       360
     atcgcccaag gcgccaaaca acagggcgta cccacgctgc tgaccggtgc atggcgtgtc       420
     gaagtcggta ccggcttcgt gcaactgacc tacaccaaag tcttcatcct ggtggccgca       480
     ttcgtcggca tgggcctgct gacctacgtc atcaagtaca ccaagctcgg gcgcatgtgc       540
     cgtgcgaccc agcaagaccg caaaatggct tcgatcctcg gcatcaacac cgacagggtc       600
     atttcctacg tgttcatcat cggtgcggcc atggcggcgt tggccggcgt gctgatcacc       660
     atgaactacg gcaccttcga cttctatgcc ggcttcatca tcggcatcaa ggcatttact       720
     gcggcagtac tgggcgggat cggttcgctg cctggcgcca tgctcggcgg gatcatcctc       780
     gggatatccg agtcgctgtt ctcgggtctg gtcaactccg actacaaaga cgtgttcagc       840
     ttctcgctgc tcgtacttgt tctggtcttc cggcctcagg gcctgctggg ccgtcctctt       900
     gtgtcgaagg tgtaa                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page