(data stored in ACNUC7421 zone)

EMBL: CP000094.PE552

CP000094.PE552       Location/Qualifiers
FT   CDS_pept        648025..649326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0554"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72298"
FT                   /db_xref="GOA:Q3KIV8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV8"
FT                   /protein_id="ABA72298.1"
FT                   /translation="MSSTTTKSIDVKKSLVEAILAGLIALIVFGPIVGVVLDGYSFNLE
FT                   PTRVAWIIAIVMAGRFALSLFLQTPKGLRILDGFESTGSGVHVLPPDYKSRLRWIIPLM
FT                   IAIAVALPFFSNSYLLGVVILGLIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLAL
FT                   GYQYLGLGFWTVLPLAAITAGLAGCILGFPVLRLHGDYLAIVTLGFGEIIRLVLNNWLS
FT                   LTGGPNGMPAPLPTFFGLEFGKRAKDGGVPFHEFFGIAYNPDVKYYFIYAVLFLVVLAV
FT                   LYIKHRLVKMPVGRAWEALREDEIACRSMGLNHVLVKLSAFTIGASTAGLAGVFFATYQ
FT                   GFVNPTSFTFFESALILAIVVLGGMGSTIGVVIAAFVLTVAPELLRGFAEYRVLLFGIL
FT                   MVLMMIWRPRGLIRISRTGVTPRKGAIHYERTAP"
     atgtcttcaa ccactacaaa atccattgat gtcaaaaaaa gcctggttga ggcgattctc        60
     gccggactga tcgccctgat cgtgttcggg ccgattgtcg gcgtggtact cgacggctac       120
     agcttcaacc tcgaaccgac ccgcgtggcg tggatcatcg ccatcgtcat ggccggccgt       180
     tttgccctca gcctgttcct gcaaaccccc aaaggcctgc gcattctcga cggattcgag       240
     agcaccggtt ccggcgtgca tgtgctgccc ccggactaca aatcgcgcct gcgctggatc       300
     atcccgctga tgatcgccat cgccgtagcg ttgccgttct tctccaactc ctacctgctg       360
     ggtgtggtca tcctcggact gatctacgtg ctgttggggc tgggactgaa catcgtggtg       420
     ggtctggccg gcctgctcga cctgggttac gtggcgttct acgccatcgg tgcctacggt       480
     ctggcgctcg ggtatcagta cctcgggctg ggcttctgga ccgtgctgcc gctcgcagcg       540
     atcaccgctg gccttgccgg ttgcatcctc ggtttcccgg tgctgcgcct gcacggcgac       600
     tacctggcga tcgtgaccct gggtttcggt gaaatcattc gtctggtgct caacaactgg       660
     ctgtccctga ccggcggccc gaacggcatg ccggcgccac tgccgacctt cttcggtctg       720
     gaattcggca agcgggcgaa ggatggcggg gtgccgttcc acgagttctt cggcatcgcc       780
     tacaacccgg acgtgaagta ctacttcatt tatgcggtgc tgttcctggt ggtgctggcg       840
     gtgctgtaca tcaagcatcg tctggtgaag atgccggttg gccgcgcttg ggaagccttg       900
     cgtgaagacg agatcgcctg ccgctcgatg ggcctcaacc acgtactggt caagctctcg       960
     gcgttcacta tcggtgcgtc caccgccggt ctggcgggtg tgttcttcgc gacttatcaa      1020
     ggcttcgtca acccgacctc gttcaccttc ttcgaatcgg cgctgatcct cgccatcgtg      1080
     gtgctcggcg gcatgggctc gaccatcggt gtggtgattg cagcgttcgt gctgacggtt      1140
     gctccggaac tgctgcgcgg cttcgccgaa taccgcgtgc tgctgttcgg catcctgatg      1200
     gtgttgatga tgatctggcg acctcgcggg ctgatccgca tcagccgtac cggggtcact      1260
     ccacgcaaag gtgccattca ctatgagagg actgcgccat ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page