(data stored in ACNUC7421 zone)

EMBL: CP000094.PE553

CP000094.PE553       Location/Qualifiers
FT   CDS_pept        649323..650195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0555"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72299"
FT                   /db_xref="GOA:Q3KIV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV7"
FT                   /protein_id="ABA72299.1"
FT                   /translation="MSEVVLSVEKLMMHFGGIKALSDVSLKVKRNSIFALIGPNGAGKT
FT                   TVFNCLTGFYKASGGKIELNVRGQQTNVIQLLGESFKPTDFVSPKNFASRLYYKMFGGT
FT                   HLVNRAGLARTFQNIRLFKEMSVLENLLVAQHMWVNRNMLAGILNTKGYRKAESDALDC
FT                   AFYWLEVVDLVDCANRLAGELSYGQQRRLEIARAMCTRPQIICLDEPAAGLNPQETEAL
FT                   SAMIRLLRDEHDLTVVLIEHDMGMVMSISDHIVVLDHGIVIAEGGPDAIRNDPKVIAAY
FT                   LGADEEEVV"
     atgagtgagg tcgtactctc tgttgaaaaa ctgatgatgc acttcggtgg catcaaggcc        60
     ttgagcgacg tcagcctgaa ggtcaaacgc aactcgatct tcgccctgat cggccccaac       120
     ggcgccggca agaccacggt gttcaactgc ctgaccgggt tctacaaggc ttccggcggc       180
     aagatcgaac tcaacgtgcg cggccagcag accaacgtca tccagctgct gggcgagtcg       240
     ttcaaaccga ccgacttcgt ctcgccgaaa aactttgcca gtcgcctgta ttacaagatg       300
     ttcggcggca cccacctggt gaaccgcgcg ggcctggccc ggacgttcca gaacattcgc       360
     ctgttcaagg aaatgtcggt gctggaaaac ctgctggtgg cccagcacat gtgggtcaac       420
     cgcaacatgc tggccggcat cctcaacacc aagggctatc gcaaggccga aagtgatgcg       480
     ctggactgcg cgttctactg gctggaagtg gtggatctgg tggactgcgc caaccgtctg       540
     gccggtgaac tgtcctacgg ccagcaacgc cgtctggaaa tcgcccgggc catgtgcacg       600
     cggccgcaga tcatctgcct cgacgaaccg gccgccggcc tcaaccctca ggaaaccgaa       660
     gcgctgagcg cgatgatccg gctgctgcgc gacgagcacg atctgaccgt ggtgctgatc       720
     gaacacgaca tgggcatggt aatgagcatt tccgatcaca tcgtggtgct ggaccacggc       780
     atcgtcatcg ccgagggcgg accggatgcc atccgtaacg atccgaaagt gatcgctgct       840
     tatctgggcg ccgacgaaga ggaagtcgta tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page