(data stored in ACNUC7421 zone)

EMBL: CP000094.PE554

CP000094.PE554       Location/Qualifiers
FT   CDS_pept        650192..650908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0556"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72300"
FT                   /db_xref="GOA:Q3KIV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIV6"
FT                   /protein_id="ABA72300.1"
FT                   /translation="MTQPILELKDLDVFYGPIQALKGVSLQINEGETVSLIGSNGAGKS
FT                   TLLMSIFGQPRAAGGQILYQGVDITHKSSHYIASNGIAQSPEGRRVFPDMTVEENLLMG
FT                   TIPIGDKYAKEDMQRMFELFPRLEERRNQRAMTMSGGEQQMLAIARALMSRPKLLLLDE
FT                   PSLGLAPIVVKQIFATLRELAKTGMTIFLVEQNANHALKLSDRAYVMVNGEIRLTGTGQ
FT                   ELLVNEEVRNAYLGGH"
     atgacgcaac ccatcctcga actcaaggat ctggacgtgt tctacggccc gatccaggcc        60
     ctcaaaggcg tttcgctgca gatcaacgaa ggagaaaccg tcagcctgat cggctccaac       120
     ggtgccggca aatccaccct gttgatgtcg atctttggcc agccacgggc ggcgggcggg       180
     cagattctct atcaaggcgt ggacattacc cacaagtcat cgcactacat cgcctctaac       240
     ggcatcgcgc agtcgccgga agggcggcgg gtgttccccg acatgaccgt cgaggaaaac       300
     ctgctgatgg gcaccattcc gatcggcgac aagtacgcca aggaagacat gcagcgtatg       360
     ttcgagctgt tcccgcggct cgaagagcgc cgtaatcagc gggccatgac catgtccggg       420
     ggcgagcagc agatgctcgc gatcgcccgg gcgctcatga gccggcccaa gctgttgctg       480
     ttggacgagc cgagcctcgg tctggcgccg atcgtggtga aacagatctt cgccaccctg       540
     cgggaactgg cgaaaaccgg catgaccatt ttcctcgtcg agcaaaacgc caaccatgcg       600
     ttgaaactgt ccgaccgggc gtacgtgatg gtcaacggcg agatccgcct gacgggcacc       660
     ggccaggaac tgctggtgaa cgaggaagtg cgtaacgctt accttggcgg tcattga          717
//

If you have problems or comments...

PBIL Back to PBIL home page