(data stored in ACNUC7421 zone)

EMBL: CP000094.PE559

CP000094.PE559       Location/Qualifiers
FT   CDS_pept        complement(655321..655935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0561"
FT                   /product="urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72305"
FT                   /db_xref="GOA:Q3KIV1"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIV1"
FT                   /protein_id="ABA72305.1"
FT                   /translation="MNTQPLRVGIGGPVGSGKTALTLALCLALRERYNLAVVTNDIYTR
FT                   EDADFLVRNEALAPERIIGVETGGCPHTAIREDASINLEAVDQLNRRFPGLDLILVESG
FT                   GDNLSATFSPELSDLTIYVIDVSAGDKLPRKGGPGICKSDLLVINKIDLAPLVGASLEM
FT                   MNSDTQRMRNGKPFVFSNQKTGQGLEEIIAFIERQGLLTAA"
     atgaacacac aacccctgcg cgtcggcatc ggcggcccgg tcggttccgg caagaccgcg        60
     ttgaccctgg ccctgtgcct ggccctgcgc gagcgttaca acctggcggt ggtcaccaac       120
     gacatctaca cccgcgaaga cgccgacttt ctggtgcgca acgaagccct ggcaccggaa       180
     cgcatcatcg gcgtggaaac cggtggctgc ccgcacaccg cgattcggga ggacgcctcg       240
     atcaacctcg aagcggtgga tcagctgaac cggcgttttc cggggctgga cctgattctg       300
     gtggaatccg gcggcgacaa cctgtcagcg accttcagcc cggaactgtc cgacctgacc       360
     atctacgtga tcgacgtgtc ggccggcgac aagctgccgc gcaagggcgg gcccggcatt       420
     tgcaaatccg acctgctggt gatcaacaag atcgaccttg cgccgctggt cggcgcctcg       480
     ctggagatga tgaacagcga cacccaacgc atgcgcaacg gcaagccgtt cgtgttcagc       540
     aaccagaaaa ccggtcaggg cctggaagaa atcatcgcct tcatcgaacg ccagggcctg       600
     ctgactgcag cctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page