(data stored in ACNUC7421 zone)

EMBL: CP000094.PE564

CP000094.PE564       Location/Qualifiers
FT   CDS_pept        658986..661061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0566"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72310"
FT                   /db_xref="GOA:Q3KIU6"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIU6"
FT                   /protein_id="ABA72310.1"
FT                   /translation="MTRTRKIFVWTFATLVLLLAVLVLIIVFFDWNRIKPPLNAKVSEE
FT                   LHRPFAINGNLSVVWRRELDEGGWRAWVPWPHVVAEDLTLGNPDWSKQPQMVTLKRVEL
FT                   RISPLALLAQRVAIPRIDLTEPNAQLQRLADGRANWTFKFDPKDPNAEPSNWVVDIGAI
FT                   GFDKGHVTLDDQTLKTNLNLLIDPLGKPIPFSDIVGDKAAKTAQDKGGAPQDYAFGLKV
FT                   TGQYHGQKLAGQGKIGGLLALQDASKPFPLQAQAKIGDTSVELAGTLTDPLNLGALDLR
FT                   LKLAGASLGNLYPLTGVTLPDTPPYATDGHLIAKLHEPDGAQFRYEQFNGKIGSSDIHG
FT                   DLAYVASQPRPKLSGALLSNQLLFADLAPLIGADSNAKQKARGGESKQPADKVLPVEEF
FT                   KTERWRDMDADVEFTGKRIVHSEELPFTDLYTHLKLNDGELSLEPLRFGVAGGNLDAQI
FT                   RLNGRTEPLEGRARLTARKFKLKQLFPTFEPMKTSFGELNGDADIAGRGNSVAKLLGGA
FT                   NGNLKMLINDGAISRELMELAGLNVGNYVVGKIFGDKEVKINCAAADFDIKTGLATTRL
FT                   FVFDTENAIIYIDGTANMATEQLDLTVTPESKGWRLISLRSPLYVRGKFIKPDAGVKAV
FT                   PLMLRGAGMVALGVIAAPAAGLLALVAPSGGEPNQCAPLLEQMKAGKAPATVKPTK"
     atgacgcgca cgcgtaaaat cttcgtctgg accttcgcca ccctcgtgct gcttctggcg        60
     gtgttggttc tgatcatcgt gtttttcgac tggaaccgga tcaagccgcc gctcaacgcc       120
     aaagtctcgg aagaattgca ccgaccgttc gccatcaacg gcaacctgtc ggtggtctgg       180
     cggcgtgaac tcgacgaggg cggctggcgc gcctgggtgc cgtggccgca tgtggtggcc       240
     gaagacctga cgctgggcaa tcccgactgg tcgaagcaac cgcagatggt cacccttaaa       300
     cgggtcgagc tgcgcatttc gccactggcc ttgctggcgc aacgggtcgc gatcccgcgc       360
     atcgacctga ccgaacccaa cgcgcaactg cagcgtctgg ctgacggccg cgccaactgg       420
     accttcaagt tcgatcccaa ggacccgaat gccgagccct cgaactgggt ggtcgatatc       480
     ggcgccatcg gcttcgacaa gggccacgtc actctggatg accagaccct caagaccaac       540
     ctcaacctgc tgatcgatcc gctgggcaag ccgattccgt tcagtgatat cgtcggcgac       600
     aaagccgcga aaaccgcgca ggacaagggc ggcgcaccgc aggattacgc cttcggcctg       660
     aaagtcaccg gccagtacca cggccagaaa ctcgccggtc agggcaagat cggcggtctg       720
     ctggccctgc aggacgcgag caaaccgttc ccgttgcagg cccaggcgaa gattggcgat       780
     accagcgtcg aactcgccgg cacattgacc gatccgctga atctcggtgc cctcgatctg       840
     cgcctgaaac tggcgggtgc cagcctcggc aacctgtatc cgctgaccgg cgtgaccctg       900
     ccggacaccc cgccgtacgc caccgacggt cacttgatcg ccaagctgca tgagccggac       960
     ggcgcgcagt tccgctacga acagttcaac ggcaagatcg gcagcagcga cattcatggc      1020
     gatctggcct atgtcgccag ccagccacgg cccaagctga gtggcgcgct gctgtccaat      1080
     caactgttgt tcgccgacct cgcaccgctg atcggtgcag actccaatgc caagcagaag      1140
     gcccgtggcg gcgaaagcaa acagccggca gacaaagtgc tgccggtgga agagttcaag      1200
     accgagcgct ggcgcgacat ggacgccgac gtcgaattca ccggcaagcg catcgtccac      1260
     agcgaagaac tgccgttcac cgacctctat acccacctga aactcaacga cggcgaactg      1320
     agcctggagc cactgcgctt tggcgtggcc ggcggcaatc tcgatgcgca gattcggctc      1380
     aacggacgta ccgagccgct ggaaggccgg gccagactga ccgcgcgcaa gttcaagctc      1440
     aaacagctgt tcccgacctt cgaaccgatg aagaccagtt tcggcgagct caacggcgat      1500
     gccgacatcg ccggtcgcgg caactcggtg gccaagttgc tgggcggcgc caacggcaac      1560
     ctgaagatgc tgatcaacga cggcgcgatc agtcgtgagt tgatggagct ggcaggcctc      1620
     aacgtcggca actacgtggt cggcaagatc tttggcgaca aggaagtgaa gatcaattgc      1680
     gcggcggcgg acttcgatat caagaccggt ctggcgacga caagactgtt tgtgttcgat      1740
     accgagaacg caatcatcta catcgacggc acggcgaaca tggccaccga gcaactggat      1800
     ctgacggtga cgccggaatc caagggctgg cgcctgattt ccctgcgctc gccgttgtat      1860
     gtacggggca agttcatcaa gccggatgcg ggggtgaaag cggtgccgtt gatgttgcgc      1920
     ggggcgggga tggtggcgct gggcgtgatc gctgcgccgg cggcggggct gctggcgctg      1980
     gtggcgccga gtggtggcga gccgaatcag tgcgcgccgt tgctggagca gatgaaggcg      2040
     ggcaaggcgc cagcgactgt caaaccgacc aaatga                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page