(data stored in ACNUC7421 zone)

EMBL: CP000094.PE567

CP000094.PE567       Location/Qualifiers
FT   CDS_pept        662814..663452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0569"
FT                   /product="putative acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72313"
FT                   /db_xref="GOA:Q3KIU3"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KIU3"
FT                   /protein_id="ABA72313.1"
FT                   /translation="MSKILAIHASPRGERSHSRRLAETFLSAWQVRHPQAQVTRREVGR
FT                   ALIPAVNEAFVAAAFYPEPEARPLTMQADLALSDQLVGELFDHDLLLISTPMYNFNVPS
FT                   GLKAWVDQIVRLGLTFDHTLDNGIAQYTPLLHGKKALIVTSRGGFGFGPGGELEALNHA
FT                   DPWLRTALGFIGINDVTVVAAEGEESAERTFAVSVAEAEQRLLDLARAF"
     atgagcaaga ttcttgcgat ccatgccagt ccacgcggtg agcgttctca ttcgcggcgt        60
     ctggcagaaa cctttctcag cgcctggcaa gtccgccatc cccaggcgca ggttacccgc       120
     cgtgaagtcg ggcgggcgct gattccggcg gttaatgagg cgtttgtcgc ggcggcgttt       180
     tacccggagc ccgaagcacg accgctgacg atgcaggccg atctggcgct cagcgatcaa       240
     ctggtgggcg agctgttcga tcacgacctg ctgctgattt ccacgccgat gtacaacttc       300
     aacgtgccca gcggcctcaa ggcctgggtc gatcagatcg tccggttggg cctgacgttc       360
     gaccacaccc tggacaacgg catcgcccaa tacacgccgc tgctgcacgg caaaaaagcg       420
     ctgatcgtca ccagtcgcgg cggcttcggt ttcggcccgg gcggcgaact ggaagcgctg       480
     aaccacgccg atccttggtt gcgcaccgcg cttggcttca tcggcatcaa cgacgtcacg       540
     gtggtcgccg ccgagggcga ggaatccgcc gagcgcacct tcgcggtgtc ggtggccgag       600
     gccgagcagc gcttgctcga cctggcccgg gcgttctag                              639
//

If you have problems or comments...

PBIL Back to PBIL home page