(data stored in ACNUC7421 zone)

EMBL: CP000094.PE57

CP000094.PE57        Location/Qualifiers
FT   CDS_pept        63929..64225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71801"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKA5"
FT                   /protein_id="ABA71801.1"
FT                   /translation="MRTLNRLLLVSLIAVSPLAAIAADDAPSSEPEVTISTHTEGDKVI
FT                   QEYSRSGFVYAIKVTPKGGKPYFLVRADGTDANYIRSDQPDMLIPSWEIFTWK"
     atgcgtacgt taaatcgctt gctgctggtc agtctgattg ctgtctcacc gctggccgcg        60
     atcgcggcgg atgatgcgcc atcgtcggag ccggaagtta ccattagcac gcacaccgaa       120
     ggcgacaagg tcattcagga atacagccgg agtgggttcg tgtatgcgat caaggtcaca       180
     ccgaagggcg gtaaacccta tttcctggtg cgcgccgatg gtacggacgc gaactacatt       240
     cgatccgacc agccggatat gctgattccg tcgtgggaaa tctttacctg gaagtaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page