(data stored in ACNUC7421 zone)

EMBL: CP000094.PE570

CP000094.PE570       Location/Qualifiers
FT   CDS_pept        complement(664737..665630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0572"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72316"
FT                   /db_xref="GOA:Q3KIU0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIU0"
FT                   /protein_id="ABA72316.1"
FT                   /translation="MQYAFPLLAIFIWAGNTVINKLAVGAIFPAEIGFYRWLLAGLLFT
FT                   PFMLKKVIAHWPQIRPNLGKIFILGVLGMAVYQSLAYFAATLTSATNMGIILSLMPLMS
FT                   LAMAIISLGQQLTAGALVGAVLSFAGVLVVVSSGSLGALLQHGVNLGDAMMLIATLAYA
FT                   IYSTLLKKWQLRLPPLVLLYLQVLVAVVVLFPLYAASPKTGLTLQNIPLVLYACLLASM
FT                   LAPLAWMQAVQRLGPSRTTLFFNLLPLITALIAAVVLKEQLALYHLVGGLLTLGGVILS
FT                   ERWTTVLGRSRTPSAA"
     atgcaatacg cgtttcccct gctggcgatt ttcatctggg ccggcaacac cgtgatcaac        60
     aagcttgcgg tcggtgcgat cttccccgcc gagatcggct tctatcgctg gctgctcgcc       120
     ggcctgctgt tcacgccgtt catgctcaag aaagtgatcg cgcactggcc gcagattcgc       180
     ccgaacctgg gcaagatttt catcctcggc gtgctcggca tggcggtcta tcagagcctg       240
     gcctacttcg ccgcgaccct gaccagcgcc accaacatgg gcatcatcct gtcgctgatg       300
     ccgttgatgt cgctggccat ggcgatcatc agcctcggcc agcaactgac tgccggtgcg       360
     ctggtcggtg cggtgctgtc gttcgccggt gtgctggtgg tggtgtcgtc cggcagcctc       420
     ggcgctttgc tgcaacacgg ggtgaacctg ggtgacgcga tgatgctgat cgccaccctc       480
     gcctatgcga tctacagcac cctgctgaaa aaatggcagc tgcgcctgcc gccgctggtg       540
     ttgctgtatt tgcaggtgct ggtggcggtg gtggtgctgt ttccgctgta cgccgcgtcg       600
     ccgaaaaccg gcctgactct gcagaacatt ccgctggtgt tgtacgcgtg cctgctggcc       660
     tcgatgctcg cgccgctggc ctggatgcag gccgtacagc gcctgggccc gagccggacc       720
     acgctgttct tcaacctgct gccgctgatc accgcgctga ttgccgcggt ggtgctgaag       780
     gaacaactgg cgttgtatca cctggtcggt ggcttgctga cgctgggcgg ggtgattctt       840
     tccgagcgct ggaccaccgt cctcggtcgc tcccgcactc cgagcgccgc ctag             894
//

If you have problems or comments...

PBIL Back to PBIL home page