(data stored in ACNUC7421 zone)

EMBL: CP000094.PE573

CP000094.PE573       Location/Qualifiers
FT   CDS_pept        667241..668254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0575"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72319"
FT                   /db_xref="GOA:Q3KIT7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT7"
FT                   /protein_id="ABA72319.1"
FT                   /translation="MPTFSERHVVFWVSCIIIFGGLLLVLPLRLLPSLLAGLLVFELVN
FT                   MLTPQLQRLIEGRRARWLAVALLGTLVVSVLTLIFAGAISFLLHEAENPGASLDKFMGV
FT                   VDRARGQLPPFIDAYLPASAAEFRVAIGEWASKHLSELQLVGKDAAHMFVTLLIGMVLG
FT                   AIIALQRVPDVTKRKPLAAALFDRLHLLVQAFRNIVFAQIKISLLNTFFTGIFLAVVLP
FT                   LFGIKLPLTKTLIVLTFLLGLLPVIGNLMSNTLITIVGLSLSIWVAIAALGYLIFIHKL
FT                   EYFLNARIVGGQISAKSWELLLAMLVFEAAFGLPGVVAGPIYYAYLKSELKLGGMV"
     atgccaacgt tttctgagcg tcatgtagtg ttctgggtca gttgcatcat cattttcggc        60
     ggtctgttgc tggtgttgcc attgcgtttg ctgcccagtc tgctggccgg attgctggtg       120
     ttcgaactgg tcaacatgct caccccgcaa ctgcagcggc tgatcgaagg ccgccgcgcg       180
     cgctggctgg cggtggcgct gctgggcacg ctggtggtaa gtgtgctgac gctgatcttc       240
     gctggcgcca tcagtttcct gctgcatgag gcggaaaacc ctggcgcttc cctcgacaaa       300
     ttcatgggcg tggtcgaccg tgcgcgtgga cagttgccgc cgttcatcga cgcctacctg       360
     ccggccagcg ctgccgaatt ccgggtggcc atcggtgaat gggcgagcaa gcatttgtcc       420
     gaactgcaac tggtgggcaa ggacgcggcg catatgttcg tgaccttgct gatcggcatg       480
     gtgctgggcg cgatcatcgc cttgcagcgc gtgccggacg tcaccaagcg caagccgctg       540
     gcggccgcac tgttcgaccg tctgcacctg ctggttcagg cgtttcgcaa catcgtgttc       600
     gcgcagatca agatttccct gctcaacacc ttcttcaccg ggatcttcct ggcggtggtc       660
     ctgccgctgt tcgggatcaa gctgccgctg accaagaccc tgatcgtgct gaccttcctg       720
     ctcggtctgc taccggtgat cggcaacctg atgtcgaaca cgctgatcac tatcgtcggc       780
     ctgtcgctgt cgatctgggt ggcgattgcg gcgttgggtt acctgatctt tatccacaag       840
     ctggaatact ttctcaacgc gcgcatcgtc ggcgggcaga tcagtgccaa gtcctgggag       900
     ttgctgctgg cgatgctggt gttcgaggcc gcgttcggcc tgccgggggt ggtggcgggg       960
     ccgatctatt acgcgtatct gaagagtgag ttgaagctgg gcgggatggt ttag            1014
//

If you have problems or comments...

PBIL Back to PBIL home page