(data stored in ACNUC7421 zone)

EMBL: CP000094.PE574

CP000094.PE574       Location/Qualifiers
FT   CDS_pept        complement(668400..669674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0576"
FT                   /product="putative chaperone/heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72320"
FT                   /db_xref="GOA:Q3KIT6"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT6"
FT                   /protein_id="ABA72320.1"
FT                   /translation="MKDASPARACGIDFGTSNSTVGWLRPGMETMIALEDDKITLPSVV
FT                   FFNIEERRPVYGRLALHEYLEGYEGRLMRSLKSLLGSKLIKHDTSVLGTAMPFKDLLGL
FT                   FIGQLKSRAEAAAGREFEQVVLGRPVFFVDDDPLADQEAEDTLVEVARKLGFKDVSFQY
FT                   EPIAAAFDYESTIEKEELVLIVDIGGGTSDFSLVRLSPERRGVDNRHDDILATGGVHIG
FT                   GTDFDKQLSLQGLMPLFGYGSRMKSGAFMPTSHHMNLATWHTINSVYSQKSTLALGSMR
FT                   YDIEDTGGIDRLFKLIEQRAGHWLAMEVEETKIHLTHNDSRHVPLDRIEPGLSVELTRA
FT                   LFESAIESQLERVRGSVTQLLADANVAVGQVDTVFFTGGSSGIPALRNSVSAMLPNARH
FT                   VEGNIFGSIGSGLAIEAMKRYGSVN"
     atgaaagacg cctctccagc ccgtgcctgc ggcatcgact tcggcacgtc caactccacc        60
     gtcggctggc tgcgccccgg catggaaacg atgatcgcgc tggaagacga caagatcacc       120
     ctgccatcgg tggtcttttt caatatcgaa gagcgccgtc cggtatacgg ccgtctggcg       180
     ctgcacgagt acctggaagg ctacgaaggc cgactgatgc gctcgctcaa gagcctgctc       240
     ggttccaagc tgatcaagca cgacaccagc gttctcggca ccgcaatgcc gttcaaggac       300
     ctgctcgggc tgttcatcgg ccagctcaag agccgcgccg aagccgccgc cggtcgggag       360
     ttcgagcagg tggtgctggg ccgcccggtg ttcttcgtcg acgacgatcc gctggccgac       420
     caggaagccg aagacaccct ggtggaagtg gcgcgcaaac tcggtttcaa ggacgtgtcg       480
     ttccagtacg agccgattgc cgcggccttc gactacgagt cgaccatcga aaaggaagaa       540
     ctggtgctga tcgtcgacat cggcggtggt acgtcggact tctcgctggt gcgcctgtcg       600
     cccgagcgtc gtggtgtgga taatcgccac gacgacatcc tcgccaccgg cggcgtgcac       660
     atcggcggga ccgacttcga caaacagttg agcctgcaag gcctgatgcc gctgttcggc       720
     tacggcagcc ggatgaaaag cggcgcgttc atgccgacca gccaccacat gaacctggcg       780
     acctggcaca ccatcaactc ggtgtactcg cagaaatcga ccctggccct gggcagcatg       840
     cgctacgaca tcgaagacac cggcggcatc gaccgtctgt tcaagctgat cgaacagcgc       900
     gccggccatt ggctggcgat ggaagtggaa gaaaccaaga tccacctgac ccacaacgac       960
     agccgccatg tgccgctgga tcgcatcgag ccgggcctga gcgtggaact gacccgggcg      1020
     ctgttcgaat cggcgatcga gtcgcagctc gagcgcgtgc gcggcagcgt cacccagttg      1080
     ctggcggacg ccaatgtggc ggtgggtcag gtcgatacgg tgttcttcac cggtggttcg      1140
     agcggcattc cggcactgcg caacagcgtc tcggcgatgc tgccgaacgc gcggcatgtg      1200
     gaagggaata tttttggcag cattggtagc ggtctggcga ttgaggccat gaaacgttac      1260
     ggctcggtga actga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page