(data stored in ACNUC7421 zone)

EMBL: CP000094.PE575

CP000094.PE575       Location/Qualifiers
FT   CDS_pept        669968..670918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0577"
FT                   /product="curved DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72321"
FT                   /db_xref="GOA:Q3KIT5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT5"
FT                   /protein_id="ABA72321.1"
FT                   /translation="MDFKDYYKILGVEPTADDKAIKAAYRKLARKYHPDVSKEKDAEAK
FT                   FKDASEAYEALKSADKRAEYDELRRYGQHGQPFQGPPGWQSRGGFGGGGGDTGDFSDFF
FT                   SSIFGNRGPGFGGGAGRQSRSAGRRGQDVELELPIFLEETLSNESKKISFQVPQYNGSG
FT                   QHVSNTSKSLNVKIPAGVTDGERIRLKGQGAPGIGGGANGDLYLTIRFAPHPKFDVEGE
FT                   NLIITLPLAPWELALGAEVAVPTLTGKINLKVPAGSQNGQRMRAKGHGLQNKAGERGYL
FT                   FVQLKAVMPKANGDDVKALWQELAKKAAFNPRENF"
     atggacttca aagactatta caagatactc ggcgtggagc cgacggctga cgacaaggca        60
     atcaaggctg cctatcgcaa gctggcgcgc aaataccacc ccgatgtcag caaggaaaag       120
     gacgccgagg ccaagttcaa ggacgcctcg gaagcctacg aagcgctgaa aagcgccgac       180
     aagcgcgccg aatacgacga actgcgtcgt tatggtcagc acggccagcc gtttcagggc       240
     ccaccggggt ggcagagccg tggcggcttt ggcggcggcg gtggcgacac cggcgacttc       300
     tcggacttct tcagttcgat cttcggcaat cgcggccccg gtttcggtgg cggcgctggc       360
     cggcaatccc gcagcgccgg acggcgaggg caagacgtgg aactggaact gccgatcttt       420
     ctggaggaga cgctttcgaa cgaatcgaaa aagatcagct tccaggtccc gcaatacaac       480
     ggttcgggcc agcacgtcag caacaccagc aaaagcctga acgtgaagat cccggcgggc       540
     gtgaccgatg gcgagcgcat ccgcctcaag ggccagggtg caccgggcat aggtggcggc       600
     gccaatggcg atctgtacct gaccatccgt ttcgcgccgc acccgaaatt cgacgttgaa       660
     ggcgaaaacc tgatcatcac cttgccgctg gcaccgtggg agctggcgct gggcgccgaa       720
     gtcgccgtgc cgaccctgac cggcaagatc aacctcaagg tcccggccgg cagccagaac       780
     ggccagcgca tgcgtgccaa gggccacggt ctgcagaaca aggcgggcga gcgcggttat       840
     ctgttcgtcc agctcaaggc cgtgatgccg aaagccaacg gcgatgacgt caaggcgctg       900
     tggcaggaac tggcgaagaa ggccgccttc aatccgcgcg agaacttctg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page