(data stored in ACNUC7421 zone)

EMBL: CP000094.PE577

CP000094.PE577       Location/Qualifiers
FT   CDS_pept        complement(671257..672384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0579"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72323"
FT                   /db_xref="GOA:Q3KIT3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIT3"
FT                   /protein_id="ABA72323.1"
FT                   /translation="MRLSEFILANIDAIVDEWEKFAATITPPADHLDSAGLRDHASAIL
FT                   RAAARDMSKPQSRDEQVAKAKGEGPEKSPSLDEAGASHGELRHTVGFDLVQMTSEFRHL
FT                   RAVVIRRWVEHIELPDTTCFQDMIRFNEAIDEALAESTAAYAEQVNRSRDIFLAILGHD
FT                   LRAPLQAVSMSTELLMRKTTLEGDALTCALNIKQGARHMAAMVSDLLELVRSRLGRSLP
FT                   IEPAPMDLADAARAAIAEACAGNPDSDPTLNTEGDTRGVWDAGRIDQLLQNLIGNALQH
FT                   GSDPREVIVTLKGEARQVLLTVHNYGPPISEEAIGTIFDPLVRSADEELGQPSTSLGLG
FT                   LFIVKEVVTAHGGTIEVSSSAANGTLFSVMLPRQV"
     atgcgtcttt ccgagttcat cctggccaat atcgacgcaa tcgtcgatga atgggaaaag        60
     tttgccgcta ccattacccc gcccgccgac catctggact cggccggtct gcgcgatcac       120
     gccagcgcca tcctgcgggc cgccgctcgc gacatgagca aaccgcaaag ccgcgacgaa       180
     caggtcgcca aggccaaggg cgaaggcccg gagaaaagcc cgagcctgga tgaagccgga       240
     gccagccatg gcgagctgcg ccacaccgtc ggtttcgatc tggtacagat gacctcggag       300
     tttcgccacc tgcgcgccgt ggtgatccga cgctgggtcg agcatatcga attaccggac       360
     accacctgct tccaggacat gatccgcttc aacgaagcca tcgacgaagc cctggccgaa       420
     tcgaccgccg cctatgccga acaggtcaac cgctcacggg acatttttct cgccattctc       480
     ggccatgacc tgcgcgcgcc cctgcaagcg gtgagcatgt ccaccgagtt gctgatgcgc       540
     aaaaccacgc tggaaggcga tgcgctgact tgtgcgctga acatcaaaca gggcgcgcgg       600
     cacatggcgg ccatggtcag cgacctgctg gaactggtac gcagccgcct gggcagaagc       660
     ctgccgatcg aaccggcgcc aatggatctg gccgacgcgg cgcgagcagc cattgccgaa       720
     gcgtgcgccg gcaatccgga cagtgacccg acattgaaca ccgagggtga cacccgtggt       780
     gtctgggacg ctggtcggat cgatcaactg ctgcagaacc tgatcggcaa tgccttgcag       840
     catggctctg atccgcgcga agtgatcgtg acgttgaagg gggaagccag gcaggtgctt       900
     ctgaccgtgc acaattacgg cccgcccatt tccgaagagg ccatcggcac cattttcgac       960
     cccttggtac gcagcgccga cgaagaactc ggccagccgt cgaccagcct gggtctgggc      1020
     ctgttcatcg tcaaggaagt ggtgaccgcc catggcggga cgatcgaagt cagctcaagc      1080
     gcagccaacg gcacgctgtt cagcgtgatg ctgccccgac aggtttaa                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page