(data stored in ACNUC7421 zone)

EMBL: CP000094.PE584

CP000094.PE584       Location/Qualifiers
FT   CDS_pept        complement(677005..677703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0586"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72330"
FT                   /db_xref="GOA:Q3KIS6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS6"
FT                   /protein_id="ABA72330.1"
FT                   /translation="MLQVDKLHQYYGGSHILRGLSFDVKVGEVTCLLGRNGVGKTTLLK
FT                   CLMGLLPAKEGAVNWEGQPITTYKPHQRVHAGIAYVPQGREIFGRLTVEENLLMGLSRF
FT                   PGSEAKEVPAFIYELFPVLLQMKQRRGGDLSGGQQQQLAIGRALASRPRLLILDEPTEG
FT                   IQPSVIKEIGAVIKKLAARGDMAILLVEQFYDFAAELADQYLVMSRGEIVQQGRGENME
FT                   SEGVRGLVTI"
     atgctgcaag tcgacaagct gcaccagtac tacggcggta gccacatcct gcgtggtctg        60
     agcttcgacg tgaaggtcgg cgaagtgacc tgcctgctcg gccgtaacgg cgtgggcaag       120
     accacgctgc tcaaatgcct gatgggcctg ttgccggcca aggaaggcgc ggtgaactgg       180
     gaaggccaac cgatcaccac gtacaagccg catcaacggg tgcacgccgg aatcgcctac       240
     gtgccccagg gccgggagat cttcggccga ctgaccgtgg aagaaaacct gctgatgggc       300
     ctgtcgcgtt tccccggcag cgaagccaaa gaggttcccg cgttcattta cgagctgttc       360
     ccggtgctgc tgcaaatgaa acagcggcgc ggcggcgacc tgtccggcgg acagcaacaa       420
     cagctggcca tcggtcgtgc actggccagc cgtccgcgtc tgctgatcct cgacgaaccc       480
     accgaaggca tccagccgtc ggtgatcaag gaaatcggcg cggtgatcaa gaagctcgcg       540
     gcccgtggcg acatggcgat tctgctggtg gagcagttct acgatttcgc cgccgaactg       600
     gccgatcagt acctggtgat gtcccggggc gagatcgtgc agcagggccg tggagaaaat       660
     atggaaagcg agggtgtacg cggactggtt acgatctaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page