(data stored in ACNUC7421 zone)

EMBL: CP000094.PE585

CP000094.PE585       Location/Qualifiers
FT   CDS_pept        complement(677841..678710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0587"
FT                   /product="putative amino acid ABC transport system,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72331"
FT                   /db_xref="GOA:Q3KIS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017781"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS5"
FT                   /protein_id="ABA72331.1"
FT                   /translation="MRVTASAEFMLEPAFFPVEPNKDEGTSRDSIGLGQRVGPGLDTRH
FT                   GTILTLEDISVSFDGFRALNNLNLYIGVGELRCIIGPNGAGKTTLMDVITGKTRPSHGK
FT                   AWFGETLDLTQMSEVQIAQAGIGRKFQKPTVFEALSVFENLELAQKTDKSVWASLRAKL
FT                   SGEQKDRISEVLDTIRLTTSVNRPAGLLSHGQKQFLEIGMLLMQDPQLLLLDEPVAGMT
FT                   DAETEFTAELFKSLAGKHSLMVVEHDMGFVGSIADHVTVLHQGSVLAEGSLEQVQDNER
FT                   VIEVYLGR"
     atgagagtca cggcgagcgc tgaattcatg ctggaaccgg cgtttttccc ggtggaaccg        60
     aacaaggacg aaggcaccag ccgcgactcg atcggcctcg ggcaacgcgt cggtccgggc       120
     ctcgacaccc gccacggcac gatcctgacc ctggaagaca tcagcgtcag cttcgacggc       180
     ttccgggcgc tgaacaatct gaacctgtac atcggcgtcg gcgaactgcg ctgcatcatc       240
     ggccccaacg gcgcgggcaa gaccacgctg atggacgtga tcaccggcaa gacccggccg       300
     agccacggca aggcgtggtt cggtgaaacc ctcgacctga cgcagatgag cgaagtgcag       360
     atcgcccagg ccggcatcgg tcgcaagttc cagaaaccga cggtgttcga agcgctgagc       420
     gtgttcgaaa acctggagct ggcgcagaaa accgacaagt cagtgtgggc cagcctgcgg       480
     gcgaagttga gcggcgagca gaaagaccgg atcagcgaag tgctcgacac cattcgcctg       540
     accacctcgg tcaatcgccc agcggggctg ctgtcccacg gacagaaaca gtttctggaa       600
     atcggcatgt tgctgatgca ggacccgcaa ttgctgctgc tcgatgaacc ggtggcgggc       660
     atgaccgacg ccgaaaccga gttcaccgcc gagctgttca agtcgctggc gggcaagcat       720
     tcgctgatgg tggtggaaca cgacatgggc ttcgtcggct cgattgccga ccacgtcacc       780
     gtgttgcatc agggcagcgt gctggccgag gggtcgctgg aacaggtgca ggacaacgag       840
     cgcgtgatcg aggtttacct cggtcgctga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page