(data stored in ACNUC7421 zone)

EMBL: CP000094.PE587

CP000094.PE587       Location/Qualifiers
FT   CDS_pept        complement(679786..681288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0589"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72333"
FT                   /db_xref="GOA:Q3KIS3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS3"
FT                   /protein_id="ABA72333.1"
FT                   /translation="MPTALYRLILAVALLLPMAVHAGDAEDFVAANPMQQAKLLEAWAA
FT                   QPDPARGELINALQQGELTVDGQPKTLRLNNRLRGLIDTALASHQLLAADAKTRLTAAQ
FT                   QLQKSAKPAQLKFLDRQLAGEIDESVHAALSLALANLQLVDTDPAVRLAAVRLLGETGD
FT                   PLARTRLEGLLEPGIETDANVRTAAETSLAQVKRKLLVGELLGQAFSGMSLGSILLLAA
FT                   LGLAITFGLLGVINMAHGEMLMLGAYSTYVVQLMFQRYAPQAIEFYPLIALPVAFFVTA
FT                   AIGMALERTVIRHLYGRPLETLLATWGISLMLIQLVRLVFGAQNVEVANPAWLSGGIQV
FT                   LPNLVLPYNRIVIIAFALFVVVLTWLLLNKTRLGLNVRAVTQNRNMAACCGVPTGRVDM
FT                   LAFGLGSGIAGLGGVALSQIGNVGPDLGQSYIIDSFLVVVLGGVGQLAGSVFAAFGLGI
FT                   ANKILEPQIGAVLGKILILALIILFIQKRPQGLFALKGRVID"
     atgcccactg ccctttaccg cttgatcctg gccgtcgcac ttttgctgcc gatggccgtc        60
     catgccgggg atgcggaaga cttcgtcgcc gccaacccga tgcaacaggc caaactgctg       120
     gaagcctggg ccgcgcagcc cgatccggcg cgtggcgaac tgatcaacgc cctgcaacaa       180
     ggcgaactga ccgtcgacgg ccaacccaag accctgcgcc tgaacaaccg cctgcggggt       240
     ctgatcgaca ccgcgctggc cagccaccag ttgctcgccg ccgacgccaa aacccgtctg       300
     actgccgcgc agcaattgca gaaaagcgcc aaaccggcgc agctgaaatt cctcgaccgg       360
     caactggctg gcgaaatcga tgaaagcgtc cacgccgccc tgagcctggc actggccaac       420
     ctgcaactgg tcgacactga cccggcggtg cgcctcgcgg ccgtgcgtct gctcggtgaa       480
     accggcgacc cgctggctcg cacccgcctc gaaggcttgc tcgaacccgg catcgaaacc       540
     gatgccaacg tgcgcaccgc cgccgaaacc agcctcgccc aggtcaagcg caaactgctg       600
     gtcggcgaac tgctcggcca ggcgttcagc ggtatgtccc tcggttcgat tctgctgctc       660
     gcggcactcg gcctggcgat caccttcggc ctgctcggcg tgatcaacat ggcccacggc       720
     gagatgctga tgctcggcgc ctactcgacc tacgtcgtgc agttgatgtt ccagcgctac       780
     gccccgcagg ccatcgagtt ctatccactg attgcgctgc cggtggcgtt cttcgtcacg       840
     gccgccatcg gcatggccct ggagcgcacg gtgatccgtc acctctacgg ccgcccgctg       900
     gaaaccctgc tcgccacctg gggcatcagc ctgatgctga ttcagctggt gcgtctggtg       960
     ttcggtgcgc aaaacgtgga agtggcaaat ccggcatggc tgtccggcgg gattcaggtg      1020
     ttgccgaatc tggtgctgcc gtacaaccgc atcgtgatca tcgccttcgc cttgtttgtg      1080
     gtggtgctga cctggctgct gctgaacaag acccgcctcg gtctgaacgt gcgtgccgtc      1140
     acccagaacc gcaacatggc cgcctgctgc ggcgtgccca ccgggcgcgt cgacatgctc      1200
     gccttcggcc tcggctcggg cattgccggg ctcggcggcg tggcgctgag ccagatcggc      1260
     aacgtcggcc cggacctcgg ccagagctac atcatcgact cgttcctggt ggtggtgctc      1320
     ggcggcgtcg gccaactggc cggcagcgtg ttcgccgcgt tcggcctggg catcgccaac      1380
     aagattctcg aaccgcagat cggtgcggtg ctcggcaaga tcctgatcct cgcgctgatc      1440
     attctgttca tccagaaacg tccgcaaggc ctcttcgcac tgaaaggacg ggtgatcgac      1500
     tga                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page