(data stored in ACNUC7421 zone)

EMBL: CP000094.PE59

CP000094.PE59        Location/Qualifiers
FT   CDS_pept        complement(65282..66211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0059"
FT                   /product="putative zinc ABC transport system,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71803"
FT                   /db_xref="GOA:Q3KKA3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR035520"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKA3"
FT                   /protein_id="ABA71803.1"
FT                   /translation="MVIVSRLFSVFVVFITGFLLIGPAQAEVRVLTSIKPLQLIAAAVQ
FT                   DGVAIPEVLLPPGASPHNYALRPSDVRKVQSVDLLYWIGPDMEGFLPRVLNGRTLPSVA
FT                   VQDLPGMKLRRFAADSHSHAEEADEHDHDHRPGSLDAHLWLSPVNARVIADKMAADLSA
FT                   ADPANAERYQSNAKAFDERLDALDQRLKKRLASVEGKPYFVFHEAFDYFEDAYGLKHTG
FT                   VFSVAAEVQPGAQHVAAMRARLQEVGKTCVFSEPPLRPRLAETLVAGLPVKLAELDALG
FT                   GYTPATAQGYEQVLEKLGNDLAGCLESL"
     gtggtcatcg tgtcccgact tttttctgtt tttgtcgtat tcatcaccgg ttttctgctg        60
     atcggcccgg ctcaggccga ggtcagagtc ctcaccagca tcaagcccct gcaactgatt       120
     gccgctgcgg tgcaggacgg cgtggcgatt ccggaagtgc tgctgccacc gggggcttcg       180
     ccacataact acgcgttgcg tccgtccgac gtacgcaagg tgcaatcggt ggatctgctg       240
     tactggatcg gcccggacat ggaaggtttc ctgcctcgcg tgctgaacgg tcgtacgctg       300
     ccgagcgttg ccgtgcagga tctgccgggc atgaaactgc gccgcttcgc cgcggacagt       360
     cattcccatg ccgaagaagc cgacgaacac gatcacgacc atcgcccggg cagcctcgat       420
     gcacatctgt ggctatcgcc ggtgaacgcg cgggttattg ccgacaaaat ggccgctgac       480
     ctgagcgctg cagacccggc caatgccgag cgttatcaga gtaacgccaa agcgttcgac       540
     gagcgtctgg atgcactgga tcagcgtttg aagaaacgcc tggccagtgt tgaaggcaaa       600
     ccctacttcg tcttccacga agccttcgac tacttcgaag acgcctacgg cttgaaacac       660
     actggcgtgt tcagcgtcgc ggcggaagtg caacccggcg cccagcatgt ggcggcgatg       720
     cgcgcgcggt tgcaggaagt cggcaagacc tgcgtgttca gtgagccgcc gctgcgtcca       780
     cgtctggccg agaccctggt ggcaggcctg ccggtgaaac tggcagaact ggatgcgcta       840
     ggcgggtaca cgccagcgac ggctcagggt tacgagcaag tgctggagaa gctggggaat       900
     gatctggcgg gttgtctcga atcgctctga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page