(data stored in ACNUC7421 zone)

EMBL: CP000094.PE590

CP000094.PE590       Location/Qualifiers
FT   CDS_pept        complement(683926..684873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0592"
FT                   /product="putative iron ABC transport system, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72336"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIS0"
FT                   /protein_id="ABA72336.1"
FT                   /translation="MTVRSLLCLALLLGTTQAFAEATKYPLTIHSCNREVTFKQAPKHA
FT                   VSHDINMTQMMLVLGLKSKMAGYSGVSGWKSVTPEMQSLLDGLPELAAKYPSVETLLNA
FT                   NVDFFFAGWDYGMRVGGDLTPQTLQPLGINVYELTESCAFVMKRPAATLDDTYNDLRNL
FT                   GKIFDVQDRANALIADMQSQVAEIRKDLPAEKPRVFLYDSGEDRAMTSGRLGMPQALID
FT                   AAGGRNVLDDVEASWTRVNWETVVERNPQVIVIVDYSEITAEQKIEFLLKNKALQSVDA
FT                   IKNQRFIVIPYVQATPGIDNVLAVETLAKGFHGE"
     atgactgtgc gctccctgct ttgcctcgcc ctgttgctgg gcaccaccca agcctttgcc        60
     gaggccacga agtacccgct gacgatccac agctgcaatc gcgaagtgac cttcaagcaa       120
     gcgccgaaac acgcggtcag tcacgacatc aacatgaccc agatgatgct cgtcctcggc       180
     ctcaaatcga agatggccgg ctacagcggc gtcagtggct ggaaatcggt gacgcctgaa       240
     atgcagtcgc tgctcgacgg tttgccggaa ctggcggcca agtacccgtc ggtagaaacc       300
     ctgctcaacg ccaacgtcga tttcttcttc gccggctggg attacggcat gcgcgtcggt       360
     ggcgatctca ccccgcagac cctgcaaccg ctgggcatca acgtctatga gctgaccgag       420
     tcctgcgcct tcgtgatgaa acgcccggcc gccacgctgg acgacactta caacgacctg       480
     cgcaacctcg gaaagatttt cgacgtgcag gaccgtgcca acgcattgat cgcagacatg       540
     caaagtcagg tcgcggaaat tcgcaaagac ctgcctgccg aaaaaccacg ggtattcctg       600
     tacgacagcg gcgaagaccg cgccatgacc tccggccgcc tcggcatgcc gcaagcgctg       660
     atcgacgccg ccggcgggcg caacgttctc gatgacgtcg aagcgagctg gacccgggtc       720
     aattgggaaa ccgtggtcga gcgcaatccg caggtgatcg tgatcgtcga ctacagcgaa       780
     atcaccgccg agcagaagat tgaattcctg ctgaagaaca aggccctgca atcggtggac       840
     gcgatcaaga accagcgctt tattgtcatc ccctacgtgc aggccacgcc ggggatcgac       900
     aacgtgctgg cggttgaaac cctggccaaa gggttccacg gcgaatga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page