(data stored in ACNUC7421 zone)

EMBL: CP000094.PE593

CP000094.PE593       Location/Qualifiers
FT   CDS_pept        complement(687960..689339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0595"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72339"
FT                   /db_xref="GOA:Q3KIR7"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIR7"
FT                   /protein_id="ABA72339.1"
FT                   /translation="MKQPKPNFYNLAWRWHFYAGLFVAPFMVMLALTGIIYLFKPQLDS
FT                   LMYSSLLNVPAGHHTVPADDLLQKVKSAYPQGQVTQYLPPVNAERSAQFVVANAGHELN
FT                   VFVDPYHGDILGEQDAKQNLQAIARAIHGELMIGTVGDRLIEMAAGWGVVLVVSGVFLW
FT                   WPRGQAAGILWPRLSSRGRVLWRDLHAVTGFWGAALLLVMLLSGMTWTGFWGKQYAQVW
FT                   NVFPAAMWDNVPTSDVEAGSLNNAARQTVPWAMENTPMPMSGDHAEHMAHGGMQHGPAA
FT                   PTIRLQDVQNIAVERKVEPGYSITMPTTATGVFTIAVFADDPRNDATLHVDQYTGKVLA
FT                   DVRFEQYGAVARATEIGVMLHEGKMFGTFNQIIVLLICLMILLSAVSGVVIWWKRRPQG
FT                   KFGVPPLRHDLPKWKTGVAIMLVLAVVFPLVGASLVVVWLLDRLLLSRLARQTESASTS
FT                   S"
     atgaaacagc ccaaaccgaa tttctacaac ctggcctggc gttggcattt ctatgccgga        60
     ttgttcgtcg cgccattcat ggtgatgctg gccctgaccg gcatcattta cctgttcaaa       120
     ccgcagctcg attcgctgat gtacagcagc ctgctgaacg tccccgccgg gcatcacacg       180
     gtgccggccg acgacttgct gcaaaaggtc aaaagcgctt atccacaggg ccaggtcacc       240
     cagtacctgc cgccggtaaa tgccgagcgc agcgcgcagt ttgtcgtggc caatgccggc       300
     catgagctga acgtgttcgt cgatccgtac cacggcgaca tccttggcga gcaggatgcc       360
     aagcagaacc tgcaagccat cgcccgggcg attcacggcg agttgatgat cggcaccgtc       420
     ggtgaccgac tgatcgaaat ggccgccggc tggggcgtgg tgctggtggt gtccggggtt       480
     ttcctgtggt ggccgcgagg tcaggcagcg gggattctgt ggccacgcct gagcagtcgc       540
     ggccgcgtgc tgtggcgtga cctgcatgcc gttaccggat tctggggcgc cgcgttgctg       600
     ctggtgatgc tgctcagcgg catgacctgg accggtttct ggggcaagca gtacgcgcag       660
     gtgtggaacg tgttcccggc ggcgatgtgg gacaacgtgc cgacttccga tgtcgaggcc       720
     ggcagcctca ataacgccgc gcgccagacc gtgccgtggg cgatggaaaa caccccgatg       780
     ccgatgtccg gcgaccacgc cgaacacatg gcccacggcg gtatgcaaca cggccccgct       840
     gcaccgacca tccgcctgca ggacgtgcaa aacatcgccg ttgagcgcaa ggtcgagccg       900
     ggctacagca tcacaatgcc gaccaccgcc accggcgtgt tcaccatcgc cgtgttcgcc       960
     gacgacccac gcaacgacgc caccctgcac gtcgatcagt acaccggcaa ggtgctggcc      1020
     gatgtgcgct tcgagcagta cggcgcggtt gcccgggcta ccgagatcgg cgtgatgctc      1080
     cacgaaggca agatgttcgg cactttcaac cagatcatcg tgctgctgat ctgcctgatg      1140
     attttgctca gcgccgtcag cggcgtggtg atctggtgga agcgtcgacc acagggcaag      1200
     ttcggcgtgc cgccgctgcg ccacgatctg ccgaagtgga aaaccggggt ggcgatcatg      1260
     ctggttctgg cggtggtgtt tccgctggtg ggggcttcgc tggtggtggt gtggttgctg      1320
     gatcggctgc tgttgtcgcg tctggcccgg caaactgaat ctgcctcaac ttcatcgtga      1380
//

If you have problems or comments...

PBIL Back to PBIL home page