(data stored in ACNUC7421 zone)

EMBL: CP000094.PE597

CP000094.PE597       Location/Qualifiers
FT   CDS_pept        complement(692620..693021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0599"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72343"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIR3"
FT                   /protein_id="ABA72343.1"
FT                   /translation="MNRHRLAFAWIACFAVLFNMLAMPLTGAMAQAAQTPAEQLLWSSF
FT                   CTGSGTKMVAIDIGSLDQKAPQSGDHHSTMQHCWCCSGSAPVVALPGHSPQLYFARYES
FT                   NRSVAPVVLQTPTPRQQWPSLNPRASPLV"
     atgaaccgac accggctcgc atttgcctgg atcgcctgct ttgcagtgct gttcaacatg        60
     ctcgccatgc cgttgacggg agcgatggcg caggcggcgc agacaccggc cgagcagttg       120
     ctgtggagca gtttctgcac cggcagcggg acgaagatgg tggcgatcga catcggcagc       180
     ctcgatcaga aagcgccgca gagtggtgac catcattcga ccatgcagca ttgctggtgc       240
     tgttccggat cggcgccggt ggtggcgttg ccggggcatt cgccgcagct gtatttcgct       300
     cgatacgaaa gcaatcgcag cgtggcgccc gtcgtgctgc aaactccgac accgcgccag       360
     caatggccga gcctcaatcc ccgcgcctct cctctggtct ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page