(data stored in ACNUC7421 zone)

EMBL: CP000094.PE60

CP000094.PE60        Location/Qualifiers
FT   CDS_pept        66269..66751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0060"
FT                   /product="putative zinc transport-related regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71804"
FT                   /db_xref="GOA:Q3KKA2"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKA2"
FT                   /protein_id="ABA71804.1"
FT                   /translation="MPITPIASRPHDHSHCVHSALSEADALCAQKGLRLTALRRRVLEL
FT                   VWQSHKPLGAYDILAVLSEQDGRRAAPPTVYRALDFLLENGLVHRISSLNAFVGCVHPK
FT                   HSHQGQFLICRECHAAIELEQKTISDAIVHSAKDVGFIVEAQTVEVVGLCSGCRGA"
     atgcctatta caccgattgc cagccgtccc cacgaccact cgcactgcgt tcatagcgcg        60
     ctgtccgagg ccgatgctct gtgtgcacag aaaggcctgc gcctgaccgc gctgcgccgg       120
     cgggtgctgg agctggtctg gcagagccac aagccgctgg gtgcctacga cattctggcg       180
     gtgctcagcg agcaggacgg ccgccgcgcc gcgccgccaa ccgtgtaccg cgcgctggat       240
     ttcctgctgg aaaacggtct ggtgcaccgc atctcctcgc tcaacgcctt cgtcggctgt       300
     gttcacccga aacattcgca ccaaggccag ttcctgatct gccgtgaatg ccacgccgcc       360
     atcgagcttg agcaaaaaac catcagcgac gccatcgtcc acagcgctaa ggatgtcggc       420
     ttcatcgttg aggcccagac cgtcgaagtg gtcggtctct gctccggttg ccggggggct       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page