(data stored in ACNUC7421 zone)

EMBL: CP000094.PE609

CP000094.PE609       Location/Qualifiers
FT   CDS_pept        complement(716752..719529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0611"
FT                   /product="putative sensor kinase/response regulator fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72355"
FT                   /db_xref="GOA:Q3KIQ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIQ1"
FT                   /protein_id="ABA72355.1"
FT                   /translation="MRWLRIAIGFTVTLLTLLCMLPAQAAQGSGWSVLLDDQGNLQLSD
FT                   IRSARYTNQFSPIELDRLTAAEPDGALWLRFRLAPGKHEQVLRIFAPDLSHLNLYVLDG
FT                   DRLIEQRDTGTAQPQAERPLPSSDFMLPLPQSDKPLDVYLRLVSDHQLRPYITLQAAVM
FT                   AAANHNQTLIYGLLFGCLAMLILHNLIRYAYTRSRSSLWLAVCEGLLSLSLLLLLNLAG
FT                   PWLPNWHAIQTPGAYLALLLTAPAGLMFAYRFFAPLGPHPLNKLLIGDILFIVICSLLL
FT                   LFVNTLPLNIITYALVALAGLSMLLVGFYHWQKGYRPARLFVAAMVVFNIGTLIILPAL
FT                   LGLTLVAPQGLIMTLMGFICISGLLMSIALGERQRSITESRFSISRDLAASNAEINAKA
FT                   EFLAKISHEIRTPMNGVLGMTELLLGTPLSVKQRDYVQTIHSAGNELLTLINEILDISR
FT                   LESGQIELDDVQFDLNALIDDCLSIYRAKAEQQNVELISFIQPQVPRVISGDPTRLRQT
FT                   LLSLLENALKKTEEGEVLVVVALDERSAGPRLRIAVQDSGQPMDQEERDALMHAELHSK
FT                   HFLSANRLGGNLGLVIARQLIRLMQGEFGIKSGASQGSTLWLTLPLDPDRLEHPTSDLD
FT                   SPLQGARVLVVDDNDTCRKVLVQQCSAWGLNVSAVPSGKEALALLRTKAHLRDYFDVVL
FT                   LDQNMPGMTGMQLAAKIKEDPSLNHDILLIMLTGISNAPSKIIARNSGIKRILAKPVAG
FT                   YTLKTTLADELNQRNRGQVVFQPQVASPAAPVKVPSDFRILVAEDNTISTKVIRGMLGK
FT                   LNLQPDTASNGEEALQAMKAQRYDLVLMDCEMPILDGFSATQQLRAWEVGNQRIRTPIV
FT                   ALTAHILAEHKERARQAGMDGHMAKPVELSQLRELIEHWVAQRDQQNRATTQPS"
     gtgcgctggc tcaggattgc cataggcttc accgtcacgc tgttgacctt gctctgcatg        60
     ctcccggccc aggccgcgca aggcagtggc tggtcggtat tgcttgacga tcagggcaac       120
     ctccagctga gcgacatccg ctccgcccgc tacaccaatc aattcagccc catcgagctt       180
     gaccgcctga ccgcggccga acccgatggc gccttgtggc tgcgtttcag actggcgccc       240
     ggcaagcacg aacaagtgct gcggatcttc gcccccgacc tgtcgcacct caatctgtat       300
     gtactcgacg gtgatcgact gatcgaacaa cgcgacaccg gcaccgctca gccccaggcg       360
     gagcgaccgc tgcccagcag cgatttcatg ctgccgctgc cccagagtga caagcccctc       420
     gacgtctacc tgcgactggt ttccgatcac cagttgcgcc cgtacatcac cctgcaagcg       480
     gcggtgatgg ccgcggccaa tcacaaccag acgctgatct acggcctgct gttcggctgt       540
     ctggcgatgt tgatcctgca caacctgatc cgctatgcct acacccgctc gcgcagcagc       600
     ctgtggctcg cggtgtgtga aggtctgttg agcctgagcc tgttgctgtt gctcaacctc       660
     gccggcccgt ggttgccgaa ctggcacgcg atccagactc ccggcgccta tctggccctg       720
     ctgctgaccg cgcccgccgg cctgatgttc gcctaccgtt tcttcgcccc gctcggcccg       780
     catccgctga acaagctgct gatcggcgac atcctgttca tcgtgatctg cagcctgttg       840
     ctgttgttcg tcaacaccct gccgctgaac atcatcacct acgcgctggt ggccctggcc       900
     ggcctgagca tgctgctggt gggtttctac cactggcaga aaggctaccg ccctgcccgg       960
     ctgttcgttg ccgcaatggt ggtgttcaac atcggcacgc tgatcatcct cccggccttg      1020
     ctggggctga ccctggtggc gccgcagggc ctgatcatga ccctgatggg tttcatctgc      1080
     atcagcggcc tgttgatgag catcgccctc ggcgagcgtc aacgcagcat caccgaaagc      1140
     cgtttcagca tcagccgcga cctcgcagcg agcaacgccg aaatcaacgc caaggccgag      1200
     ttcctggcca agatcagcca cgaaatccgc acgccgatga acggcgtact gggcatgacc      1260
     gaactgctgc tcggcacgcc actgtcggtc aaacaacgcg actacgtgca gaccatccac      1320
     agcgccggca acgaactgct gaccctgatc aacgagatac tcgacatctc gcggctcgag      1380
     tccgggcaga tcgaactcga cgatgtacag ttcgatctca acgcgctgat cgacgattgc      1440
     ctgagcatct accgcgccaa ggccgaacag cagaacgtcg agctcatcag tttcatccag      1500
     ccgcaagtgc cacgggtcat cagtggcgac ccgacgcgcc tgcgtcagac gctgctgagc      1560
     ctgctggaaa acgccctgaa gaaaaccgaa gaaggcgaag tgctggtggt ggtcgccctc      1620
     gacgaacgca gcgccggccc acgcctgcgc attgccgtgc aggacagcgg ccagccgatg      1680
     gatcaggaag agcgcgacgc gctgatgcac gccgagttgc acagcaagca cttcctgtcg      1740
     gccaaccgcc tgggcggcaa cctcggtctg gtgatcgccc gccaattgat ccgcctgatg      1800
     cagggcgagt tcggcatcaa gagcggcgcc agccagggca gcacgctgtg gctgactctg      1860
     ccgctggacc cagatcgcct ggagcatccg acctcggatc tcgacagccc gctgcaaggc      1920
     gcgcgcgtgc tggtggtgga cgacaacgac acctgccgca aggtgctggt gcagcaatgc      1980
     agcgcctggg gcctgaacgt cagcgccgtg ccgtcgggca aggaagcgct ggccctgctg      2040
     cgcaccaaag cgcatttgcg tgattacttc gacgtggtcc tgctggacca gaacatgccc      2100
     ggcatgaccg gcatgcaact ggcggccaag atcaaggaag acccgagcct gaaccacgac      2160
     atcctgctga tcatgctcac cggcatcagc aatgcgccga gcaagatcat cgcgcgcaac      2220
     tcagggatca agcgcatcct ggccaaaccg gtggccggct acaccctcaa gaccacgctc      2280
     gccgatgaac tgaaccagcg caatcgtggc caggtggtgt tccagccaca ggttgcgagc      2340
     cccgccgcgc cggtcaaggt gccgagtgat ttccgtattc tggtggccga agacaacacc      2400
     atttcgacca aggtgatccg gggcatgctc ggcaaactca acctgcagcc cgacaccgcc      2460
     agcaatggcg aagaagcctt gcaggcgatg aaagcccagc gctacgacct ggtgttgatg      2520
     gactgcgaaa tgccgatcct cgacggcttc tccgccaccc agcaactgcg ggcctgggaa      2580
     gtcggcaacc agcgcatccg cacgccgatc gtggcgctga ccgcgcacat cctcgccgag      2640
     cacaaggaac gcgcgcgcca ggccgggatg gacgggcaca tggccaaacc ggtggagctg      2700
     tcgcaactgc gcgagctgat cgagcactgg gtggcccagc gtgatcagca gaaccgagcg      2760
     acgacgcaac cgtcgtga                                                    2778
//

If you have problems or comments...

PBIL Back to PBIL home page