(data stored in ACNUC7421 zone)

EMBL: CP000094.PE616

CP000094.PE616       Location/Qualifiers
FT   CDS_pept        complement(726625..727983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0618"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72362"
FT                   /db_xref="GOA:Q3KIP4"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIP4"
FT                   /protein_id="ABA72362.1"
FT                   /translation="MTAKLEKVLIANRGEIALRILRACKEMGIKTVAVYSKADKELMHL
FT                   GLADESVCIGPASAAHSYLHIPAIIAAAEVTGATAIHPGYGFLAENADFAEQVENSGFA
FT                   FIGPKAETIRLMGDKVSAKHAMIEAGVPTVPGSDGPLPEDEETALRIGREVGYPVIIKA
FT                   AGGGGGRGMRVVHKEEDLIASAKLTRSEAGAAFGNPMVYLEKFLTNPRHVEVQVLSDGQ
FT                   GNAIHLGDRDCSLQRRHQKVLEEAPAPGIDENARKEVLARCVKACIDIGYRGAGTFEFL
FT                   YENGRFYFIEMNTRVQVEHPVSEMVTGIDIVKEMLSIAAGNKLSYTQDDVVIRGHSLEC
FT                   RINAEDPKTFMPSPGTVKHFHAPGGNGVRVDSHLYSGYAVPPNYDSLIGKLITYGATRD
FT                   EAMARMRNALDEIVVDGIKTNIPLHRDLTRDEGFCKGGVNIHYLEHKLAGEKH"
     atgactgcga agttggaaaa agttctgatc gctaaccgcg gtgagatcgc cctgcggatt        60
     ctgcgtgcct gcaaagagat gggcatcaag accgtcgccg tttactccaa ggccgacaaa       120
     gagctgatgc acctgggtct ggcagacgaa tccgtctgca tcggcccggc ttctgccgcg       180
     cactcctacc tgcacatccc ggcaatcatt gcggccgctg aagtgactgg cgctaccgcc       240
     attcacccag gctacggttt cctcgcggaa aacgccgact ttgccgagca ggtcgagaac       300
     tccggcttcg ccttcatcgg cccgaaagcc gaaaccattc gcctgatggg cgacaaggta       360
     tcggccaagc acgcgatgat cgaagcgggc gtgccaaccg ttccaggttc cgacggcccg       420
     ctgccggaag acgaggaaac ggcgctgcgc atcggtcgtg aagtcggcta tccggtgatc       480
     atcaaggccg ccggcggcgg tggtggtcgc ggcatgcgtg tggtgcacaa ggaagaagac       540
     ctgatcgcct cggcaaagct gacccgctcc gaagctggcg cggcgttcgg caacccgatg       600
     gtctatctgg aaaaattcct gaccaatccg cgtcacgtcg aagtgcaggt tctgtccgac       660
     ggccagggca acgccatcca tctgggcgac cgcgattgct cgctgcaacg ccgtcaccag       720
     aaagttctcg aagaagcacc ggcaccgggc atcgatgaga acgcgcgcaa ggaagtcctg       780
     gcccgctgcg tcaaggcgtg catcgacatc ggctaccgtg gcgccggcac cttcgagttc       840
     ctgtacgaga acggtcgttt ctacttcatc gaaatgaaca cccgtgttca ggtggagcac       900
     ccggtttcgg aaatggtcac cggtatcgac atcgtcaagg agatgctcag catcgccgct       960
     ggcaacaagc tgtcgtatac ccaggatgat gtggtgatcc gcggtcactc gctggaatgc      1020
     cggatcaacg ccgaagaccc gaaaaccttc atgccgagcc cgggcacggt caagcatttc      1080
     cacgcaccag gcggcaacgg cgttcgcgtc gattcgcacc tgtacagcgg ttatgccgtt      1140
     ccgccgaact acgactcgct gatcggcaag ctgatcactt acggcgcgac ccgcgacgaa      1200
     gccatggccc gcatgcgcaa tgccctggac gaaatcgtgg tcgacgggat caagaccaac      1260
     atcccgctgc accgtgatct gacccgcgac gaaggcttct gcaaaggggg cgtgaacatt      1320
     cactacctcg agcacaagct ggctggcgag aagcactaa                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page