(data stored in ACNUC7421 zone)

EMBL: CP000094.PE62

CP000094.PE62        Location/Qualifiers
FT   CDS_pept        67529..68317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0062"
FT                   /product="high-affinity zinc ABC transport system, membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71806"
FT                   /db_xref="GOA:Q3KKA0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKA0"
FT                   /protein_id="ABA71806.1"
FT                   /translation="MADFLFYALLAGLALAVVAGPLGSFVVWRRMAYFGDTLSHAALLG
FT                   VALGFLLDVSPTVAVTVGCLLLAVLLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFM
FT                   HEVRIDLMAYLFGDLLAISPTDLAWILGGSAAVLVLLVTLWRPLLAITVHEELARVEGL
FT                   SVAGLRMALMLLIAVVIAVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASVLGM
FT                   LAVCGGLALSWFKDTPAGPSIVVTAAALFLLSFVLPRRGV"
     atggctgatt ttctgttcta cgccctgctt gcaggtctgg cgctggcggt ggtcgcgggg        60
     ccgctcggct cgttcgtggt ctggcggcgc atggcctatt tcggcgatac gctgtcccac       120
     gccgcattgc tcggcgtggc gttgggcttt ttgctggatg tcagcccgac cgtggcggtg       180
     accgtgggct gcctgctgct ggcggtgttg ctggtgacct tgcagcagcg tcagccactg       240
     gcgtccgaca cgcttctggg aattctcgca ccaagcacgc tctctctcgg gctggtggta       300
     ctaagcttca tgcatgaagt gcggatcgac ctgatggcct atctgttcgg cgacctgctg       360
     gcgatcagcc cgaccgatct ggcgtggatc ctcggcggca gcgcggcggt gctggtgctg       420
     ctggtgacct tgtggcgccc gctgctggca atcaccgtgc acgaagagct ggccagggtc       480
     gaaggcctgt cggtggccgg tttgcgcatg gcgctgatgc tgttgatcgc ggtggtgatc       540
     gcagtggcga tgaaaatcgt cggtgtgttg ctgattactt cgctattgat cattccggcg       600
     gctgcggcac agcgtcacgc ccgttctccg gagcagatgg cactgggtgc gagcgtgctg       660
     ggcatgctcg ccgtttgtgg cgggctggcg ctgtcctggt tcaaggacac cccggccggc       720
     ccgtcaatcg ttgtgacggc ggccgcactg tttctgctga gttttgttct gccccgtcga       780
     ggggtgtag                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page