(data stored in ACNUC7421 zone)

EMBL: CP000094.PE76

CP000094.PE76        Location/Qualifiers
FT   CDS_pept        complement(79897..80784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0076"
FT                   /product="putative cytochrome C oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71820"
FT                   /db_xref="GOA:Q3KK86"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK86"
FT                   /protein_id="ABA71820.1"
FT                   /translation="MATHEHYYVPAQSKWPIVATVGMFVTVYGLATWFNDLKAARPESH
FT                   GPLIFFVGGLLLAYMLFGWFGTVIKESRAGLYSPQLDRSFRWGMSWFIFSEVMFFIAFF
FT                   GALFYVRHISGPALGGEGTKGIAHMLWPNFQFTWPLLHTPDPKLFPPPKEVISPWGLPL
FT                   INTILLVSSSVTITIAHHALKKGHRGALKLWLAITVLLGCAFLGFQAEEYIHAYHELGL
FT                   TLGSGIYGATFFMLTGFHGAHVTIGTIILFVMLMRIMKGHFDNEHQFGFEAASWYWHFV
FT                   DVVWIGLFIFVYVL"
     atggcaactc atgagcacta ttacgtcccg gcccagagca agtggccgat cgtcgccacg        60
     gtggggatgt tcgtcaccgt gtacggtctg gcgacctggt tcaacgatct gaaggcagcg       120
     cgtccggaat cccacggccc gctgatcttt ttcgtcggcg gcctgttgct ggcgtacatg       180
     ctgttcggct ggttcggcac ggtgatcaag gaaagccgcg cgggcttgta cagcccacaa       240
     ctggaccgct cgttccgctg gggcatgagc tggttcatct tctccgaggt gatgtttttc       300
     atcgccttct tcggcgcgct gttctacgtg cgacacatct ctggcccggc gctgggcggc       360
     gaaggcacca aaggcatcgc ccacatgctc tggccgaact tccagttcac ctggccgctg       420
     ctgcacacgc cggatccgaa actgttccca ccgcccaagg aagtcatcag cccctggggc       480
     ctgccgctga tcaacaccat cctgctggtg agttccagcg tgaccatcac catcgcccac       540
     cacgcgctga agaaaggcca tcgcggcgcg ctgaaactgt ggctggcgat caccgtgctg       600
     ctgggctgcg cgttcctcgg cttccaggcc gaagaataca tccacgccta ccacgaactg       660
     gggctgaccc tcggctcggg catctacggc gcgacgttct tcatgctcac cggtttccac       720
     ggcgcccacg tgaccatcgg cacgatcatt ctgttcgtga tgctgatgcg catcatgaag       780
     ggccatttcg acaacgaaca tcagttcggt tttgaagcgg cgagctggta ttggcacttc       840
     gtcgatgtgg tgtggatcgg cttgttcatc ttcgtttatg tgctttaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page