(data stored in ACNUC7421 zone)

EMBL: CP000094.PE79

CP000094.PE79        Location/Qualifiers
FT   CDS_pept        complement(83064..84191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0079"
FT                   /product="putative cytochrome C oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71823"
FT                   /db_xref="GOA:Q3KK83"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK83"
FT                   /protein_id="ABA71823.1"
FT                   /translation="MMRHPHVWMGLLLWSIFSPVQAAWTVNMAPGATEISHAVFDLHMT
FT                   IFWICVVIGIIVFGAMFWSMMVHRRSTGQVAAKFHESTTVEILWTVVPLLILVAMAVPA
FT                   TATLIKMYDTSEPDIDIQITGYQWKWHYKYLGQDVEFFSNLATPAEQIHNKEAKGEHYL
FT                   LEVDKPLVLPTGAKVRFLVTSADVIHSWWVPAFAVKRDAIPGFVNEAWTRIDKPGLYRG
FT                   QCAELCGKDHGFMPIVVDVKEKADYEKWLAERKAEALQLKELTSKEWTLDELKERGDKI
FT                   YHTTCVACHQAEGQGLPPMFPALKGSKIATGPKEAHLSIVFHGKPGTAMAAFGKQLSEV
FT                   DIAAVVTYERNAWGNNKGDMVTPKEVLELKQAESK"
     atgatgcgac atccacacgt ctggatgggc ctcctgttgt ggtcgatttt cagcccggtg        60
     caagctgcct ggactgtgaa tatggcgcct ggagcgactg aaatcagtca cgcagtattc       120
     gacctgcaca tgaccatttt ctggatctgt gtggtgatcg ggatcatcgt cttcggcgcc       180
     atgttctggt cgatgatggt gcaccgccgt tctaccgggc aggtcgccgc aaaattccac       240
     gaaagcacca ccgtcgaaat tctctggacc gtcgtcccgc tgctgattct ggtggcgatg       300
     gccgttccgg cgaccgcgac cctgatcaag atgtacgaca ccagtgagcc ggatatcgat       360
     atccagatca ccggttatca gtggaagtgg cactacaaat acctgggcca ggacgtcgag       420
     ttcttcagca acctggccac gcccgccgag cagatccaca acaaggaagc caagggcgag       480
     cactacctgc tcgaggtcga caagccgctg gtgctgccga ccggcgccaa ggtgcgcttc       540
     ctcgtgacct ccgccgacgt gatccactcc tggtgggtgc cggccttcgc ggtcaagcgc       600
     gatgcgattc ccgggttcgt caacgaagcc tggacccgca tcgacaagcc cggcctctac       660
     cgtggccagt gcgccgagct gtgcggcaag gatcacggct tcatgccgat cgtggtcgac       720
     gtcaaggaga aggccgacta cgaaaaatgg ctcgccgagc gcaaggccga agcgttgcag       780
     ctcaaggagc tgaccagcaa ggaatggacc ctcgacgaac tcaaggaacg tggcgacaag       840
     atctaccaca ccacctgcgt cgcctgtcac caggctgaag gccagggcct gccgccgatg       900
     ttcccggccc tcaaaggctc gaaaatcgcc accggcccga aagaggcgca cctgagcatt       960
     gtcttccacg gcaagcccgg caccgccatg gcggcgttcg gcaagcagct gtcggaagtc      1020
     gatatcgcag cggtcgtgac ctacgaacgt aacgcctggg gcaacaacaa gggcgacatg      1080
     gtcacgccaa aagaagtgct ggagctgaaa caggcggaaa gcaaatga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page